Glyma01g24960 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g24960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g24960): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g24960

Feature Type:	gene_model
Chromosome:	Gm01
Start:	32900894
stop:	32902163
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g24960

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G37760	AT	Annotation by Michelle Graham. TAIR10: NAD(P)-linked oxidoreductase superfamily protein \| chr2:15831995-15833678 FORWARD LENGTH=291	SoyBase	E_val: 2.00E-43	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0046482	GO-bp	Annotation by Michelle Graham. GO Biological Process: para-aminobenzoic acid metabolic process	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0004033	GO-mf	Annotation by Michelle Graham. GO Molecular Function: aldo-keto reductase (NADP) activity	SoyBase	N/A	ISS
GO:0016229	GO-mf	Annotation by Michelle Graham. GO Molecular Function: steroid dehydrogenase activity	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0070401	GO-mf	Annotation by Michelle Graham. GO Molecular Function: NADP+ binding	SoyBase	N/A	ISS
PTHR11732	Panther	ALDO/KETO REDUCTASE	JGI		ISS
PTHR11732:SF34	Panther	3-CHLOROBENZOATE-3,4-DIOXYGENASE DYHYDROGENASE-RELATED	JGI		ISS
PF00248	PFAM	Aldo/keto reductase family	JGI		ISS
UniRef100_G7JTF1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Aldose reductase n=1 Tax=Medicago truncatula RepID=G7JTF1_MEDTR	SoyBase	E_val: 6.00E-43	ISS
UniRef100_I1J6Z8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1J6Z8_SOYBN	SoyBase	E_val: 2.00E-156	ISS

Expression Patterns of Glyma01g24960

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g24960 not represented in the dataset	Glyma01g24960 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g24960 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma01g24960

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g24960

Limit To All Plant Sequences

>Glyma01g24960.1   sequence type=CDS   gene model=Glyma01g24960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TGTACTGATGACTTGCCGCAAGACGTCCCAAAGGCATCTGATAAAACTTTACGGGATTTGCAGCTGGACTATTTGGATCTCTACCTTATTCATTGGCCAGTCAGTGCGAATAATTGGCAGCTTACCAAACCTGACATAGCTAGCACATGGAGAGCAATGGAGGCACTCTACAATTCTGGCAAGGCTCGAGATATAGGGTGGAATTGCACCCTTCATTACAGCAGCCAAAATTACATGCTTTCTGTAAATCCAAGGGAGTGCACTTATCATAGACATCTTGTAGCAATTTCAGTGTTAACATATAGAAAAGGTTATTCACCACTGGGAAAAGGATACAGTGAAAGTAATATACTTAAAAATCCAGTTCTGCACACAACTGCAGGGAATGTACTTCCCAAGAGCACAAATGATGCAAGGCTCAAGGAAAAATTTGATCTGTTTGATTGGTCTATACCTGCTGATTTGCTTGCCAACTTCTCCGACATTAAGCAGGCAAGAGAGAAGTTACTGGAGATGGTTTTGTTAGCAAGACATCTCCTGGGTACAAAACAATTGAAGAACTCTTGGATGAGTATTGGAGAGTTTCCATATAGGCCATTTTCTCCCCTCTTAATGCAAAATGAGCGTATCGGATTATTGTAA

Predicted protein sequences of Glyma01g24960

Limit To All Plant Sequences

>Glyma01g24960.1   sequence type=predicted peptide   gene model=Glyma01g24960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTDDLPQDVPKASDKTLRDLQLDYLDLYLIHWPVSANNWQLTKPDIASTWRAMEALYNSGKARDIGWNCTLHYSSQNYMLSVNPRECTYHRHLVAISVLTYRKGYSPLGKGYSESNILKNPVLHTTAGNVLPKSTNDARLKEKFDLFDWSIPADLLANFSDIKQAREKLLEMVLLARHLLGTKQLKNSWMSIGEFPYRPFSPLLMQNERIGLL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain