SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g24960

Feature Type:gene_model
Chromosome:Gm01
Start:32900894
stop:32902163
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g24960
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G37760AT Annotation by Michelle Graham. TAIR10: NAD(P)-linked oxidoreductase superfamily protein | chr2:15831995-15833678 FORWARD LENGTH=291 SoyBaseE_val: 2.00E-43ISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0046482GO-bp Annotation by Michelle Graham. GO Biological Process: para-aminobenzoic acid metabolic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0004033GO-mf Annotation by Michelle Graham. GO Molecular Function: aldo-keto reductase (NADP) activity SoyBaseN/AISS
GO:0016229GO-mf Annotation by Michelle Graham. GO Molecular Function: steroid dehydrogenase activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0070401GO-mf Annotation by Michelle Graham. GO Molecular Function: NADP+ binding SoyBaseN/AISS
PTHR11732Panther ALDO/KETO REDUCTASE JGI ISS
PTHR11732:SF34Panther 3-CHLOROBENZOATE-3,4-DIOXYGENASE DYHYDROGENASE-RELATED JGI ISS
PF00248PFAM Aldo/keto reductase family JGI ISS
UniRef100_G7JTF1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Aldose reductase n=1 Tax=Medicago truncatula RepID=G7JTF1_MEDTR SoyBaseE_val: 6.00E-43ISS
UniRef100_I1J6Z8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1J6Z8_SOYBN SoyBaseE_val: 2.00E-156ISS

Expression Patterns of Glyma01g24960
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g24960 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma01g24960
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g24960
>Glyma01g24960.1   sequence type=CDS   gene model=Glyma01g24960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TGTACTGATGACTTGCCGCAAGACGTCCCAAAGGCATCTGATAAAACTTTACGGGATTTGCAGCTGGACTATTTGGATCTCTACCTTATTCATTGGCCAGTCAGTGCGAATAATTGGCAGCTTACCAAACCTGACATAGCTAGCACATGGAGAGCAATGGAGGCACTCTACAATTCTGGCAAGGCTCGAGATATAGGGTGGAATTGCACCCTTCATTACAGCAGCCAAAATTACATGCTTTCTGTAAATCCAAGGGAGTGCACTTATCATAGACATCTTGTAGCAATTTCAGTGTTAACATATAGAAAAGGTTATTCACCACTGGGAAAAGGATACAGTGAAAGTAATATACTTAAAAATCCAGTTCTGCACACAACTGCAGGGAATGTACTTCCCAAGAGCACAAATGATGCAAGGCTCAAGGAAAAATTTGATCTGTTTGATTGGTCTATACCTGCTGATTTGCTTGCCAACTTCTCCGACATTAAGCAGGCAAGAGAGAAGTTACTGGAGATGGTTTTGTTAGCAAGACATCTCCTGGGTACAAAACAATTGAAGAACTCTTGGATGAGTATTGGAGAGTTTCCATATAGGCCATTTTCTCCCCTCTTAATGCAAAATGAGCGTATCGGATTATTGTAA
Predicted protein sequences of Glyma01g24960
>Glyma01g24960.1   sequence type=predicted peptide   gene model=Glyma01g24960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTDDLPQDVPKASDKTLRDLQLDYLDLYLIHWPVSANNWQLTKPDIASTWRAMEALYNSGKARDIGWNCTLHYSSQNYMLSVNPRECTYHRHLVAISVLTYRKGYSPLGKGYSESNILKNPVLHTTAGNVLPKSTNDARLKEKFDLFDWSIPADLLANFSDIKQAREKLLEMVLLARHLLGTKQLKNSWMSIGEFPYRPFSPLLMQNERIGLL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo