Report for Sequence Feature Glyma01g24880
Feature Type: gene_model
Chromosome: Gm01
Start: 32798563
stop: 32800071
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma01g24880
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G02090 AT
Annotation by Michelle Graham. TAIR10: unknown protein; Has 30 Blast hits to 30 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 30; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr5:412350-412607 REVERSE LENGTH=85
SoyBase E_val: 5.00E-11 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_C6SX69 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SX69_SOYBN
SoyBase E_val: 1.00E-61 ISS
Expression Patterns of Glyma01g24880
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma01g24880 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.01g102300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma01g24880
Coding sequences of Glyma01g24880
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma01g24880.1 sequence type=CDS gene model=Glyma01g24880 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAGGGTCTAATTCCATTTGTGTACAAAGCTATAATGCAGTACAAGAATGGGAAACAAGGGCCTATCGGTTCATGGCTTTGTGAGTCACCTTCTTACTCATACATGAAACTTCCCGGTGACTCGGGTCGGTTTCATACCTCTGCTTCTTCTCTGATTGGGTCAGATTATGGTTTTTCAGCTTCTTCACCATCTTCTATGCTTGCTACTTCTTCAACCCAAATCATAGTCTCTTCCAGTGTTCAATCGCCGCACCGTTGCGTGAATTCACCAAGAGTTCCAACATGA
Predicted protein sequences of Glyma01g24880
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma01g24880.1 sequence type=predicted peptide gene model=Glyma01g24880 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEGLIPFVYKAIMQYKNGKQGPIGSWLCESPSYSYMKLPGDSGRFHTSASSLIGSDYGFSASSPSSMLATSSTQIIVSSSVQSPHRCVNSPRVPT*