SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g24880

Feature Type:gene_model
Chromosome:Gm01
Start:32798563
stop:32800071
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g24880
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G02090AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 30 Blast hits to 30 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 30; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr5:412350-412607 REVERSE LENGTH=85 SoyBaseE_val: 5.00E-11ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6SX69UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SX69_SOYBN SoyBaseE_val: 1.00E-61ISS

Expression Patterns of Glyma01g24880
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g24880 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g102300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g24880
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g24880
>Glyma01g24880.1   sequence type=CDS   gene model=Glyma01g24880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGTCTAATTCCATTTGTGTACAAAGCTATAATGCAGTACAAGAATGGGAAACAAGGGCCTATCGGTTCATGGCTTTGTGAGTCACCTTCTTACTCATACATGAAACTTCCCGGTGACTCGGGTCGGTTTCATACCTCTGCTTCTTCTCTGATTGGGTCAGATTATGGTTTTTCAGCTTCTTCACCATCTTCTATGCTTGCTACTTCTTCAACCCAAATCATAGTCTCTTCCAGTGTTCAATCGCCGCACCGTTGCGTGAATTCACCAAGAGTTCCAACATGA
Predicted protein sequences of Glyma01g24880
>Glyma01g24880.1   sequence type=predicted peptide   gene model=Glyma01g24880   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGLIPFVYKAIMQYKNGKQGPIGSWLCESPSYSYMKLPGDSGRFHTSASSLIGSDYGFSASSPSSMLATSSTQIIVSSSVQSPHRCVNSPRVPT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo