SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g24735

Feature Type:gene_model
Chromosome:Gm01
Start:32401121
stop:32402034
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g24735
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G56680AT Annotation by Michelle Graham. TAIR10: Class II aminoacyl-tRNA and biotin synthetases superfamily protein | chr5:22936645-22938841 FORWARD LENGTH=572 SoyBaseE_val: 2.00E-70ISS
GO:0006418GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA aminoacylation for protein translation SoyBaseN/AISS
GO:0006421GO-bp Annotation by Michelle Graham. GO Biological Process: asparaginyl-tRNA aminoacylation SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0004812GO-mf Annotation by Michelle Graham. GO Molecular Function: aminoacyl-tRNA ligase activity SoyBaseN/AISS
GO:0004816GO-mf Annotation by Michelle Graham. GO Molecular Function: asparagine-tRNA ligase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PTHR22594Panther ASPARTYL/LYSYL-TRNA SYNTHETASE JGI ISS
PTHR22594:SF6Panther ASPARTYL-TRNA SYNTHETASE JGI ISS
UniRef100_C6TJZ3UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TJZ3_SOYBN SoyBaseE_val: 9.00E-86ISS
UniRef100_G7LJN2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Asparaginyl-tRNA synthetase n=1 Tax=Medicago truncatula RepID=G7LJN2_MEDTR SoyBaseE_val: 3.00E-78ISS

Expression Patterns of Glyma01g24735
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g24735 not represented in the dataset
Glyma01g24735 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g24735 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma01g24735
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g24735
>Glyma01g24735.1   sequence type=CDS   gene model=Glyma01g24735   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTGGTGCTTTTGATTTTGTTGTGGATTATATGAACTGTGCCAAGGCATATGTGAAATTTAATTGTCAATGGTTACTTGACAACTGCCTTGAGGATATGGATTTTATGGCTGATAAGTTTGATAAAGGTTGCATTGACCATTTGAAATTGGTTACTTCCACTCCCTTTATTCGAGTTACATATACAGAAGCAGTGGAAATACTGGAAGACATTGTGAAGAATGGTAAGAAATTTGAAAATGAACAAAAATGGGTAATTGACTTAGCATTTGAGCATGAAAGGGATATTGAAGCATTCTACATGCGGCTCAATGATGACTTAAAGACAGTGGTTGTTATGGATGTGCTTGTACCCAAGGTTGGAAAACTAATTGGTGGAAGCCAAAGGGAAGAACATTATGATGAAATGGGTTTGCCTGTTAAGCTATATGAGTGGTACCTTGATCTAAGGCGGATGATTCTCTTTGCCACTGGCTTGGAAAATATTAGACATATGATTCCCTTCCCATGA
Predicted protein sequences of Glyma01g24735
>Glyma01g24735.1   sequence type=predicted peptide   gene model=Glyma01g24735   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFGAFDFVVDYMNCAKAYVKFNCQWLLDNCLEDMDFMADKFDKGCIDHLKLVTSTPFIRVTYTEAVEILEDIVKNGKKFENEQKWVIDLAFEHERDIEAFYMRLNDDLKTVVVMDVLVPKVGKLIGGSQREEHYDEMGLPVKLYEWYLDLRRMILFATGLENIRHMIPFP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo