Glyma01g24680 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g24680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g24680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g24680

Feature Type:	gene_model
Chromosome:	Gm01
Start:	32231086
stop:	32231557
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g24680

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G37690	AT	Annotation by Michelle Graham. TAIR10: phosphoribosylaminoimidazole carboxylase, putative / AIR carboxylase, putative \| chr2:15806111-15810240 FORWARD LENGTH=642	SoyBase	E_val: 3.00E-47	ISS
GO:0006189	GO-bp	Annotation by Michelle Graham. GO Biological Process: 'de novo' IMP biosynthetic process	SoyBase	N/A	ISS
GO:0009555	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen development	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0004638	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphoribosylaminoimidazole carboxylase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016874	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ligase activity	SoyBase	N/A	ISS
GO:0034023	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 5-(carboxyamino)imidazole ribonucleotide mutase activity	SoyBase	N/A	ISS
GO:0046872	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metal ion binding	SoyBase	N/A	ISS
PTHR23046	Panther	PHOSPHORIBOSYLAMINOIMIDAZOLE CARBOXYLASE CATALYTIC SUBUNIT	JGI		ISS
PF00731	PFAM	AIR carboxylase	JGI		ISS
UniRef100_Q8W197	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Aminoimidazole ribonucleotide carboxylase n=1 Tax=Vigna unguiculata RepID=Q8W197_VIGUN	SoyBase	E_val: 4.00E-53	ISS
UniRef100_UPI00023379DC	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00023379DC related cluster n=1 Tax=unknown RepID=UPI00023379DC	SoyBase	E_val: 2.00E-59	ISS

Expression Patterns of Glyma01g24680

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g24680 not represented in the dataset	Glyma01g24680 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g24680 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma01g24680

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g24680

Limit To All Plant Sequences

>Glyma01g24680.1   sequence type=CDS   gene model=Glyma01g24680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CCATGTGTGGGGATCATAATGGGTTCTGATTCAGATCTACCTGTTATGAAAAGTGCTGCTGAAATCTTGGAGATGTTTGGTGTGCCTCACGAGGTAAGAATAGTTTCAGCTCACAAGACTCCAGAATTGGTGTTTTCTTATGCCTCATCTGCTCATGAACGAGGCATACAAGTCATTATTGCTGGTGTTGGTGGTGCAGCTCACTTGGCTGGTATGGTGGTTGCTCTTACTCCCTTGCTTGTTATTGGCATTCCTGTGCGTGCTTCTACCTTGGATGGGATTGATTCACTCTTGTCAATTGTCCAG

Predicted protein sequences of Glyma01g24680

Limit To All Plant Sequences

>Glyma01g24680.1   sequence type=predicted peptide   gene model=Glyma01g24680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
PCVGIIMGSDSDLPVMKSAAEILEMFGVPHEVRIVSAHKTPELVFSYASSAHERGIQVIIAGVGGAAHLAGMVVALTPLLVIGIPVRASTLDGIDSLLSIVQ

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain