Glyma01g24620 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g24620): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g24620): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g24620

Feature Type:	gene_model
Chromosome:	Gm01
Start:	32161500
stop:	32162094
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g24620

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G27210	AT	Annotation by Michelle Graham. TAIR10: BRI1 suppressor 1 (BSU1)-like 3 \| chr2:11630188-11636182 FORWARD LENGTH=1006	SoyBase	E_val: 4.00E-60	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0004721	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphoprotein phosphatase activity	SoyBase	N/A	ISS
GO:0004722	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine phosphatase activity	SoyBase	N/A	ISS
GO:0005506	GO-mf	Annotation by Michelle Graham. GO Molecular Function: iron ion binding	SoyBase	N/A	ISS
GO:0016787	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity	SoyBase	N/A	ISS
GO:0030145	GO-mf	Annotation by Michelle Graham. GO Molecular Function: manganese ion binding	SoyBase	N/A	ISS
PF07646	PFAM	Kelch motif	JGI		ISS
UniRef100_Q9SHS7-2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Isoform 2 of Serine/threonine-protein phosphatase BSL3 n=1 Tax=Arabidopsis thaliana RepID=Q9SHS7-2	SoyBase	E_val: 9.00E-59	ISS
UniRef100_Q9SHS7-2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Isoform 2 of Serine/threonine-protein phosphatase BSL3 n=1 Tax=Arabidopsis thaliana RepID=Q9SHS7-2	SoyBase	E_val: 9.00E-59	ISS

Expression Patterns of Glyma01g24620

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g24620 not represented in the dataset	Glyma01g24620 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g24620 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma01g24620

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g24620

Limit To All Plant Sequences

>Glyma01g24620.1   sequence type=CDS   gene model=Glyma01g24620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTTGCTAAACATAGAGATGGTCGTTGGGAATGGGCAATTGCCCCAGGTGTCTCACCATCACCAAGATATCAGCATGCAACGGTATTTGTTAATGCAAGGGTCCATGTGTCTGGTGGGGCTCTTGGTGGAGGACGGATGGTTGAAGACACATCAAGTGTTGTAGTATTGGACATTGTTGTTGGTGTTTGGTGTGATACAAAATCTGTTGTTACCAGTCCAAGAACTGGTAGATACAGTGCTGATGTAGTAGGAGGAGATGCTGCAGCTGAGTTGACTCGATGTTGTAGGCACTCGGCTGCTGCTGTTGGTGACCTAATTTTTATTTATGGT

Predicted protein sequences of Glyma01g24620

Limit To All Plant Sequences

>Glyma01g24620.1   sequence type=predicted peptide   gene model=Glyma01g24620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LAKHRDGRWEWAIAPGVSPSPRYQHATVFVNARVHVSGGALGGGRMVEDTSSVVVLDIVVGVWCDTKSVVTSPRTGRYSADVVGGDAAAELTRCCRHSAAAVGDLIFIYG

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain