SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g24455

Feature Type:gene_model
Chromosome:Gm01
Start:31734754
stop:31736467
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g24455
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G03800AT Annotation by Michelle Graham. TAIR10: Pentatricopeptide repeat (PPR) superfamily protein | chr5:1010894-1013584 REVERSE LENGTH=896 SoyBaseE_val: 7.00E-56ISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
PTHR24015Panther FAMILY NOT NAMED JGI ISS
PF01535PFAM PPR repeat JGI ISS
UniRef100_B9SRK7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pentatricopeptide repeat-containing protein, putative n=1 Tax=Ricinus communis RepID=B9SRK7_RICCO SoyBaseE_val: 9.00E-63ISS
UniRef100_UPI0002337092UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337092 related cluster n=1 Tax=unknown RepID=UPI0002337092 SoyBaseE_val: 5.00E-118ISS

Expression Patterns of Glyma01g24455
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g24455 not represented in the dataset
Glyma01g24455 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g24455 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g099200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g24455
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g24455
>Glyma01g24455.1   sequence type=CDS   gene model=Glyma01g24455   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCGCTACACTCAAAACGGAGCACTTTGACTCCCCCTTTGTCGCCAACGCCCTTGTCTCTCTCTACACTAAGCACGCCTCTTTCCACGCCGCGCTTAAACTCTTCAACCAAATACCACGCAAGATTGTTTGAGGGAATGCCAGTCAGGGATGTTATAACTTGGACTGAGATGGTCACAACGTATATGGAGTTTGGATTGGTTAATTTGGCTTTGAAGGTGTTTGATGAAATGCTAGAGAAGAATTTTGTGTCTTATAACATGGTTCTGGCTAGGTTCTATCGAAACGAGCAAGGTTTTGAGGTGATGAGGTTGTTTGTAAGAATAGTGGATGAGGGTTTGGAATTGACAAATTTTAGTTTGACTAGTGTTGTTGATGCTTGTGGATTGCTTGGTGATTACAAGGTCAACAAGCAGGTTCATGGGTTTGCGGTGAAGTTTGGGTTTGGATCGAATGGTTATGTTGAGGCTGCGTTGCTTGACATGTACACGAGGTGTGGGAGGATGGTGGATGCTGAGAAGATATTTTTGAGATGGGTGTTGGAGGAGTTTAGCTTTGTGGTTTGGACGACAATGATATGTGGCTATGCTCGGAATGGACAATCGGAGGAGGTGATTTATCTTTTCCACGTTGGTCGATCGGATGGAAAGGTGATTATGGATGAAGTTGCAACAGCTTCAATGCTTGGTCTTTGTGGAACTATTGGTCATCTTGATATGGTTTCTTAG
Predicted protein sequences of Glyma01g24455
>Glyma01g24455.1   sequence type=predicted peptide   gene model=Glyma01g24455   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPLHSKRSTLTPPLSPTPLSLSTLSTPLSTPRLNSSTKYHARLFEGMPVRDVITWTEMVTTYMEFGLVNLALKVFDEMLEKNFVSYNMVLARFYRNEQGFEVMRLFVRIVDEGLELTNFSLTSVVDACGLLGDYKVNKQVHGFAVKFGFGSNGYVEAALLDMYTRCGRMVDAEKIFLRWVLEEFSFVVWTTMICGYARNGQSEEVIYLFHVGRSDGKVIMDEVATASMLGLCGTIGHLDMVS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo