SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g24406

Feature Type:gene_model
Chromosome:Gm01
Start:31704493
stop:31706592
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g24406
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G14390AT Annotation by Michelle Graham. TAIR10: alpha/beta-Hydrolases superfamily protein | chr5:4637551-4639575 REVERSE LENGTH=369 SoyBaseE_val: 1.00E-68ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0008284GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of cell proliferation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR12277Panther UNCHARACTERIZED JGI ISS
PTHR12277:SF8Panther UNCHARACTERIZED JGI ISS
PF02230PFAM Phospholipase/Carboxylesterase JGI ISS
UniRef100_Q2HUX9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Abhydrolase domain-containing protein FAM108C1 n=2 Tax=Medicago truncatula RepID=Q2HUX9_MEDTR SoyBaseE_val: 3.00E-90ISS
UniRef100_UPI00023379D8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023379D8 related cluster n=1 Tax=unknown RepID=UPI00023379D8 SoyBaseE_val: 6.00E-103ISS

Expression Patterns of Glyma01g24406
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g24406 not represented in the dataset
Glyma01g24406 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g24406 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma01g24406
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g24406
>Glyma01g24406.1   sequence type=CDS   gene model=Glyma01g24406   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATTTGTTACCAACAGAGAACCTGCTATCAAAATTTTCAGTCTAAGTTTTGTGATGTCAGGTTGTTGTCTAGAAGAGAGTTATGGTGCCAAGCATGAAGACATAATCCTTTATGGACAATCTGTTGGCAGTGGCCCATCTTTGGATCATGCAGCTAGGTTGCCTCAATTAATAGTTGTTGTTCTGCACTATCCTATACTTTCTGGCTTAAGGGTCGTGTATCTAAACATTGACAAGATTCCGCAAGTTAATTTTCCAATTCTCATAATTCATGGTACTTCAGATGAAGTTGTAGATTGCTCCCTTGGCAAGCAACTCTGGGGTCTATGTAAAGAGAAGTATGAACCATTGTGGCTCAAAGGAGGTAACCACTGTGATTTGGAGCTCTTTCCTGAGTACATCAGGCATCTCAAGAAGTTCATAACAACAGTTGAGAAATCTCCATCGCAACGATACAGCTTCCGGCGGAGCATAAACCAGTTTAAGCAGCCTCGAAAGAGTACAAATATTTTCAAAGTAAGTAGAAAAGGCACTGATCGTAGTTTA
Predicted protein sequences of Glyma01g24406
>Glyma01g24406.1   sequence type=predicted peptide   gene model=Glyma01g24406   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAFVTNREPAIKIFSLSFVMSGCCLEESYGAKHEDIILYGQSVGSGPSLDHAARLPQLIVVVLHYPILSGLRVVYLNIDKIPQVNFPILIIHGTSDEVVDCSLGKQLWGLCKEKYEPLWLKGGNHCDLELFPEYIRHLKKFITTVEKSPSQRYSFRRSINQFKQPRKSTNIFKVSRKGTDRSL






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo