SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma01g24136

Feature Type:gene_model
Chromosome:Gm01
Start:31384593
stop:31388267
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G68090AT Annotation by Michelle Graham. TAIR10: annexin 5 | chr1:25519442-25520774 REVERSE LENGTH=316 SoyBaseE_val: 1.00E-26ISS
GO:0009408GO-bp Annotation by Michelle Graham. GO Biological Process: response to heat SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009639GO-bp Annotation by Michelle Graham. GO Biological Process: response to red or far red light SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009827GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0030048GO-bp Annotation by Michelle Graham. GO Biological Process: actin filament-based movement SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
GO:0005544GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium-dependent phospholipid binding SoyBaseN/AISS
PTHR10502Panther ANNEXIN JGI ISS
PF00191PFAM Annexin JGI ISS
UniRef100_I1ND51UniRef Annotation by Michelle Graham. Most informative UniRef hit: Annexin n=1 Tax=Glycine max RepID=I1ND51_SOYBN SoyBaseE_val: 1.00E-54ISS
UniRef100_UPI000233DA60UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233DA60 related cluster n=1 Tax=unknown RepID=UPI000233DA60 SoyBaseE_val: 1.00E-54ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g24136 not represented in the dataset

Glyma01g24136 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g24136.1   sequence type=CDS   gene model=Glyma01g24136   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGACAATTTTTAGTGAGAAAAGCAGCATACATTTGGCTACAGTCAATTCTGCTTACATAGCTTCATATGGACACTCACTAGAAAAGGCAATAAAGAAGGAAACATCTTGCTCTTTTGGGAGTGCCCTCTTAACCATACTACGTTGTGCATGGATTCTATGCAAGTCAATGAAGGGTGTGGGAATTGATGATAGTAGACTAATAAGGGTAATTGTAACAAGGATTGAGATAGACATGCATTATATAAAAATAACATATTATAAGAAATATGGAAAACCATTAACTCATGCTGTTAAGTCAGACACATCAGGCCAAAGAGTAGAGTAA

>Glyma01g24136.1   sequence type=predicted peptide   gene model=Glyma01g24136   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVTIFSEKSSIHLATVNSAYIASYGHSLEKAIKKETSCSFGSALLTILRCAWILCKSMKGVGIDDSRLIRVIVTRIEIDMHYIKITYYKKYGKPLTHAVKSDTSGQRVE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo