|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G68090 | AT | Annotation by Michelle Graham. TAIR10: annexin 5 | chr1:25519442-25520774 REVERSE LENGTH=316 | SoyBase | E_val: 1.00E-26 | ISS |
GO:0009408 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to heat | SoyBase | N/A | ISS |
GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
GO:0009414 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to water deprivation | SoyBase | N/A | ISS |
GO:0009639 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to red or far red light | SoyBase | N/A | ISS |
GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
GO:0009827 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification | SoyBase | N/A | ISS |
GO:0009860 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pollen tube growth | SoyBase | N/A | ISS |
GO:0030048 | GO-bp | Annotation by Michelle Graham. GO Biological Process: actin filament-based movement | SoyBase | N/A | ISS |
GO:0005509 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: calcium ion binding | SoyBase | N/A | ISS |
GO:0005544 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: calcium-dependent phospholipid binding | SoyBase | N/A | ISS |
PTHR10502 | Panther | ANNEXIN | JGI | ISS | |
PF00191 | PFAM | Annexin | JGI | ISS | |
UniRef100_I1ND51 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Annexin n=1 Tax=Glycine max RepID=I1ND51_SOYBN | SoyBase | E_val: 1.00E-54 | ISS |
UniRef100_UPI000233DA60 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233DA60 related cluster n=1 Tax=unknown RepID=UPI000233DA60 | SoyBase | E_val: 1.00E-54 | ISS |
Glyma01g24136 not represented in the dataset |
Glyma01g24136 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g24136.1 sequence type=CDS gene model=Glyma01g24136 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGTGACAATTTTTAGTGAGAAAAGCAGCATACATTTGGCTACAGTCAATTCTGCTTACATAGCTTCATATGGACACTCACTAGAAAAGGCAATAAAGAAGGAAACATCTTGCTCTTTTGGGAGTGCCCTCTTAACCATACTACGTTGTGCATGGATTCTATGCAAGTCAATGAAGGGTGTGGGAATTGATGATAGTAGACTAATAAGGGTAATTGTAACAAGGATTGAGATAGACATGCATTATATAAAAATAACATATTATAAGAAATATGGAAAACCATTAACTCATGCTGTTAAGTCAGACACATCAGGCCAAAGAGTAGAGTAA
>Glyma01g24136.1 sequence type=predicted peptide gene model=Glyma01g24136 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MVTIFSEKSSIHLATVNSAYIASYGHSLEKAIKKETSCSFGSALLTILRCAWILCKSMKGVGIDDSRLIRVIVTRIEIDMHYIKITYYKKYGKPLTHAVKSDTSGQRVE*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||