Report for Sequence Feature Glyma01g24130
Feature Type: gene_model
Chromosome: Gm01
Start: 31382752
stop: 31384508
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma01g24130
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G71900 AT
Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF803) | chr1:27061754-27064053 FORWARD LENGTH=343
SoyBase E_val: 9.00E-34 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PTHR12570 Panther
UNCHARACTERIZED
JGI ISS
PF05653 PFAM
Protein of unknown function (DUF803)
JGI ISS
UniRef100_G7INM7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Magnesium transporter NIPA2 n=1 Tax=Medicago truncatula RepID=G7INM7_MEDTR
SoyBase E_val: 9.00E-36 ISS
UniRef100_UPI00023379D7 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI00023379D7 related cluster n=1 Tax=unknown RepID=UPI00023379D7
SoyBase E_val: 1.00E-40 ISS
Expression Patterns of Glyma01g24130
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma01g24130 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma01g24130
Coding sequences of Glyma01g24130
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma01g24130.1 sequence type=CDS gene model=Glyma01g24130 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
GCACTGGATACTTTTAATATGGAAGTGGTATCTCCCATATATTATGTTATGTTCACAACATTTACCATTGTGGCTAGTGTTATTATGTTTAAGGACTGGGATAGACAAAGTCCAACACAAGTTATCACAGAAATATGTGGGTTTGTGACAATTCTATCAGGAACTTTTCTTCTTCACAAAACTAAGGATATGGCTGATGCAATACATTTTAAGACGGTTATTCATAAAATCGTCTTAAAAACATTAATCTTAAAAGACGGTTCCAAAATCGTCGTTGTAGAG
Predicted protein sequences of Glyma01g24130
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma01g24130.1 sequence type=predicted peptide gene model=Glyma01g24130 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ALDTFNMEVVSPIYYVMFTTFTIVASVIMFKDWDRQSPTQVITEICGFVTILSGTFLLHKTKDMADAIHFKTVIHKIVLKTLILKDGSKIVVVE