SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g24130

Feature Type:gene_model
Chromosome:Gm01
Start:31382752
stop:31384508
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g24130
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G71900AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF803) | chr1:27061754-27064053 FORWARD LENGTH=343 SoyBaseE_val: 9.00E-34ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR12570Panther UNCHARACTERIZED JGI ISS
PF05653PFAM Protein of unknown function (DUF803) JGI ISS
UniRef100_G7INM7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Magnesium transporter NIPA2 n=1 Tax=Medicago truncatula RepID=G7INM7_MEDTR SoyBaseE_val: 9.00E-36ISS
UniRef100_UPI00023379D7UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023379D7 related cluster n=1 Tax=unknown RepID=UPI00023379D7 SoyBaseE_val: 1.00E-40ISS

Expression Patterns of Glyma01g24130
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g24130 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma01g24130
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g24130
>Glyma01g24130.1   sequence type=CDS   gene model=Glyma01g24130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GCACTGGATACTTTTAATATGGAAGTGGTATCTCCCATATATTATGTTATGTTCACAACATTTACCATTGTGGCTAGTGTTATTATGTTTAAGGACTGGGATAGACAAAGTCCAACACAAGTTATCACAGAAATATGTGGGTTTGTGACAATTCTATCAGGAACTTTTCTTCTTCACAAAACTAAGGATATGGCTGATGCAATACATTTTAAGACGGTTATTCATAAAATCGTCTTAAAAACATTAATCTTAAAAGACGGTTCCAAAATCGTCGTTGTAGAG
Predicted protein sequences of Glyma01g24130
>Glyma01g24130.1   sequence type=predicted peptide   gene model=Glyma01g24130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ALDTFNMEVVSPIYYVMFTTFTIVASVIMFKDWDRQSPTQVITEICGFVTILSGTFLLHKTKDMADAIHFKTVIHKIVLKTLILKDGSKIVVVE






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo