SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g23840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g23840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g23840

Feature Type:gene_model
Chromosome:Gm01
Start:30921785
stop:30923363
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G53920AT Annotation by Michelle Graham. TAIR10: RNApolymerase sigma-subunit C | chr3:19961041-19963820 REVERSE LENGTH=571 SoyBaseE_val: 4.00E-16ISS
GO:0006352GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, initiation SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0019685GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, dark reaction SoyBaseN/AISS
GO:0071482GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to light stimulus SoyBaseN/AISS
GO:2001141GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of RNA biosynthetic process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0003899GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA-directed RNA polymerase activity SoyBaseN/AISS
GO:0016987GO-mf Annotation by Michelle Graham. GO Molecular Function: sigma factor activity SoyBaseN/AISS
UniRef100_G7I282UniRef Annotation by Michelle Graham. Most informative UniRef hit: RNA polymerase sigma-B factor n=1 Tax=Medicago truncatula RepID=G7I282_MEDTR SoyBaseE_val: 1.00E-40ISS
UniRef100_UPI00023379D3UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023379D3 related cluster n=1 Tax=unknown RepID=UPI00023379D3 SoyBaseE_val: 1.00E-106ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g23840 not represented in the dataset

Glyma01g23840 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g23840.1   sequence type=CDS   gene model=Glyma01g23840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTAGTGTACATAAAATTTTTGATAATTCCCAAATGCCTTTTGGAGAGGTATCTACTATTTCTACGAAGTTTGAGTCATTCAGGGCACAACATTTTCGTATGTTAATGGAGAACCTATGTGTTTTAGAAGAAACTTTTGTTGATTCTGAAGCACTGAGGTTGGAAAAGGCTATTATATTGCAACTAGGAAAGGTTGGTGCTCTTGAGTTATTCAATGTTTGTCTATCAAGATCAGTTGGAACCTCACTTGTGTCAAACTATGTTGTCAAAGTGGATGACTACAAGGACAAAGTTGTTGTCCAGTCTAGCAAGAAAAAGGAAAATAAAACCAGAAGAAAGAGAGAATTTGTTGCCACAGTGCTAGCAGAGTTAGAGAAAATTAGGACAGCTATAGAAGAGGATACCAAGCCAGTAGCAAGCTTGAGTACCTGGGCAGAAGCATCTGAAGTTGATGAGAAAGTGCTATATTGCAGAATGTTATTAATATACTTTACTTGTTATCCACCAGAATTCAAAGAAATTTCATCAGTGTTAAAACTATTGATGAAGTGTCAATTAGGCCACACACAAGCACATGACCCTACCCATTTGACATTTTGCTTATTCCATTAG

>Glyma01g23840.1   sequence type=predicted peptide   gene model=Glyma01g23840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSVHKIFDNSQMPFGEVSTISTKFESFRAQHFRMLMENLCVLEETFVDSEALRLEKAIILQLGKVGALELFNVCLSRSVGTSLVSNYVVKVDDYKDKVVVQSSKKKENKTRRKREFVATVLAELEKIRTAIEEDTKPVASLSTWAEASEVDEKVLYCRMLLIYFTCYPPEFKEISSVLKLLMKCQLGHTQAHDPTHLTFCLFH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo