Glyma01g23840 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g23840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g23840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g23840

Feature Type:	gene_model
Chromosome:	Gm01
Start:	30921785
stop:	30923363
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g23840

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G53920	AT	Annotation by Michelle Graham. TAIR10: RNApolymerase sigma-subunit C \| chr3:19961041-19963820 REVERSE LENGTH=571	SoyBase	E_val: 4.00E-16	ISS
GO:0006352	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, initiation	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0019685	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, dark reaction	SoyBase	N/A	ISS
GO:0071482	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to light stimulus	SoyBase	N/A	ISS
GO:2001141	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of RNA biosynthetic process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0003899	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA-directed RNA polymerase activity	SoyBase	N/A	ISS
GO:0016987	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sigma factor activity	SoyBase	N/A	ISS
UniRef100_G7I282	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: RNA polymerase sigma-B factor n=1 Tax=Medicago truncatula RepID=G7I282_MEDTR	SoyBase	E_val: 1.00E-40	ISS
UniRef100_UPI00023379D3	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00023379D3 related cluster n=1 Tax=unknown RepID=UPI00023379D3	SoyBase	E_val: 1.00E-106	ISS

Expression Patterns of Glyma01g23840

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g23840 not represented in the dataset	Glyma01g23840 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g23840 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma01g23840

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g23840

Limit To All Plant Sequences

>Glyma01g23840.1   sequence type=CDS   gene model=Glyma01g23840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTAGTGTACATAAAATTTTTGATAATTCCCAAATGCCTTTTGGAGAGGTATCTACTATTTCTACGAAGTTTGAGTCATTCAGGGCACAACATTTTCGTATGTTAATGGAGAACCTATGTGTTTTAGAAGAAACTTTTGTTGATTCTGAAGCACTGAGGTTGGAAAAGGCTATTATATTGCAACTAGGAAAGGTTGGTGCTCTTGAGTTATTCAATGTTTGTCTATCAAGATCAGTTGGAACCTCACTTGTGTCAAACTATGTTGTCAAAGTGGATGACTACAAGGACAAAGTTGTTGTCCAGTCTAGCAAGAAAAAGGAAAATAAAACCAGAAGAAAGAGAGAATTTGTTGCCACAGTGCTAGCAGAGTTAGAGAAAATTAGGACAGCTATAGAAGAGGATACCAAGCCAGTAGCAAGCTTGAGTACCTGGGCAGAAGCATCTGAAGTTGATGAGAAAGTGCTATATTGCAGAATGTTATTAATATACTTTACTTGTTATCCACCAGAATTCAAAGAAATTTCATCAGTGTTAAAACTATTGATGAAGTGTCAATTAGGCCACACACAAGCACATGACCCTACCCATTTGACATTTTGCTTATTCCATTAG

Predicted protein sequences of Glyma01g23840

Limit To All Plant Sequences

>Glyma01g23840.1   sequence type=predicted peptide   gene model=Glyma01g23840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSVHKIFDNSQMPFGEVSTISTKFESFRAQHFRMLMENLCVLEETFVDSEALRLEKAIILQLGKVGALELFNVCLSRSVGTSLVSNYVVKVDDYKDKVVVQSSKKKENKTRRKREFVATVLAELEKIRTAIEEDTKPVASLSTWAEASEVDEKVLYCRMLLIYFTCYPPEFKEISSVLKLLMKCQLGHTQAHDPTHLTFCLFH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain