SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g23820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g23820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g23820

Feature Type:gene_model
Chromosome:Gm01
Start:30803139
stop:30810796
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G49640AT Annotation by Michelle Graham. TAIR10: Aldolase-type TIM barrel family protein | chr3:18400480-18402809 REVERSE LENGTH=329 SoyBaseE_val: 1.00E-179ISS
GO:0006808GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of nitrogen utilization SoyBaseN/AISS
GO:0008033GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA processing SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0017150GO-mf Annotation by Michelle Graham. GO Molecular Function: tRNA dihydrouridine synthase activity SoyBaseN/AISS
GO:0050660GO-mf Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding SoyBaseN/AISS
PTHR11082Panther TRNA-DIHYDROURIDINE SYNTHASE JGI ISS
PTHR11082:SF4Panther NITROGEN REGULATION PROTEIN NIFR3-RELATED JGI ISS
PF01207PFAM Dihydrouridine synthase (Dus) JGI ISS
UniRef100_I1J6V8UniRef Annotation by Michelle Graham. Most informative UniRef hit: tRNA-dihydrouridine synthase n=3 Tax=Glycine max RepID=I1J6V8_SOYBN SoyBaseE_val: 0ISS
UniRef100_UPI00023372CAUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023372CA related cluster n=1 Tax=unknown RepID=UPI00023372CA SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g23820 not represented in the dataset

Glyma01g23820 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g36840 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g097500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g23820.3   sequence type=CDS   gene model=Glyma01g23820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGTACCGCAACAAACTCGTTCTCGCCCCTATGGTTCGCGTTGGCACTCTCCCATTTAGATTACTAGCTGCTCAATATGGTGCAGATATCACTTACGGCGAGGAAATCATTGACCACAAGATGCTCAAGTGCGACCGCCAAATCAACGAACTCATTGGATCCACTGATTTTGTGGAGAAGGGGACAAAAAATGTTGTGTTTAGAACCTGCGATGAAGAAAAGGATACGGTTGTATTTCAAATAGGCACATCAGATGCTGTGAGGGCCCTAGCTACTGCTCAGTTAGTGTGTAATGATGTTGCTGCTGTAGATATTAACATGGGTTGCCCGAAGTCATTTTCTGTGAGTGGTGGGATGGGTGCTGCTCTGTTGTCCAAACCAGAGCTTATTCATGATATCTTAACAACATTAAGGAGGAATTTGAACACACCAGTAACATGTAAGATTCGACTTCTAAAATCGCCACATGATACCGTGGAATTAGCCAGACGAATTGAGAAAACTGGTGTTTCTGCTCTTGCAGTCCATGGAAGAAAAGTCCCAGATAGGCCCAGAGATCCTGCTAAGTGGAATGAAATCGCTGATGTTGTGTCAGCATTATCTATTCCAGTTATAGCAAATGGTGATGTTTTTGAGTATGATGATTTTGAACGCATTAAATCTGCCACAGGTGCCTCGTCAGTGATGGTTGCCAGAGGGGCACTCTGGAATGCTTCAATGTTTTCGCCTGAAGGCAAAGTTTCTTATGAAGCTGTGAAAAGAGAATATATTAGGAAGTGCATCTTGTGGGATAACGATTTAAAAAGCACCAAGCATACATTAAAGGAAATGATAATGCATTATTCTTGCCTAGAACTGCCTGAAGGGAAGGCTGTGATCAAATCAGAGTCCATGGCTGATCTAGCGTAA

>Glyma01g23820.3   sequence type=predicted peptide   gene model=Glyma01g23820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEYRNKLVLAPMVRVGTLPFRLLAAQYGADITYGEEIIDHKMLKCDRQINELIGSTDFVEKGTKNVVFRTCDEEKDTVVFQIGTSDAVRALATAQLVCNDVAAVDINMGCPKSFSVSGGMGAALLSKPELIHDILTTLRRNLNTPVTCKIRLLKSPHDTVELARRIEKTGVSALAVHGRKVPDRPRDPAKWNEIADVVSALSIPVIANGDVFEYDDFERIKSATGASSVMVARGALWNASMFSPEGKVSYEAVKREYIRKCILWDNDLKSTKHTLKEMIMHYSCLELPEGKAVIKSESMADLA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo