SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g23662): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g23662): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g23662

Feature Type:gene_model
Chromosome:Gm01
Start:30575166
stop:30577235
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g23662
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G57110AT Annotation by Michelle Graham. TAIR10: autoinhibited Ca2+ -ATPase, isoform 8 | chr5:23109729-23116857 REVERSE LENGTH=1074 SoyBaseE_val: 9.00E-17ISS
GO:0006754GO-bp Annotation by Michelle Graham. GO Biological Process: ATP biosynthetic process SoyBaseN/AISS
GO:0006812GO-bp Annotation by Michelle Graham. GO Biological Process: cation transport SoyBaseN/AISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0006882GO-bp Annotation by Michelle Graham. GO Biological Process: cellular zinc ion homeostasis SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009624GO-bp Annotation by Michelle Graham. GO Biological Process: response to nematode SoyBaseN/AISS
GO:0070588GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transmembrane transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0005388GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium-transporting ATPase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0015662GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism SoyBaseN/AISS
GO:0043621GO-mf Annotation by Michelle Graham. GO Molecular Function: protein self-association SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
UniRef100_G3LY22UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auto-inhibited Ca2+-transporting ATPase 10 n=1 Tax=Solanum lycopersicum RepID=G3LY22_SOLLC SoyBaseE_val: 1.00E-19ISS
UniRef100_I1MSK0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MSK0_SOYBN SoyBaseE_val: 1.00E-41ISS

Expression Patterns of Glyma01g23662
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g23662 not represented in the dataset
Glyma01g23662 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g23662 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g094400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g23662
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g23662
>Glyma01g23662.1   sequence type=CDS   gene model=Glyma01g23662   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAACCTGTAAGCACAAATATTTCTCTGGGCATACTAGAAACCCAGATGGAAGTGTTCAATTTATAGTGGGCAAGACCAAAGTTGGTGATGCTATTGATGGAGTAATTAAGATATTCACTGTCACGGTCACCATTGTAGTAGTTGCAGTGCATGAAGGGCTACCTTTAGCAATGGCTGTGGTTGAGGCTTGGATTGGTGGTGGGAAGAAGATTGTTGATCCTCATGATGTATCACAGTTCTCTCGTATGCTCTGCTATTTTGTATATATCCCTGAGGGTGGTAATGATGTTAAGGTTTCTGAATCACCAACAGAAAAGGCAATATTAGAGTGGGGAATTAATTATTCATTAAATTTTTTGGCTTGCAAATGTCAACTTTTATACTGGTCATTACAAGAGGATAATCTTGTTTTATTGGCTATTATTGGCCTAAAGGATCCTTGTCTACCTGGTGTCAAAGATGCAATACAGCTTTGCCAAAAGGCTGGGGTTGAGCCTCTGTTTGGTAAGAGGGAAATAGGAGGAGGAGAAAGGATGAAATTCATTTGTGGTGTTTGGTGTGAGAAAAAGAGAATGGAAATATTTTTAAAAATGGTGGGACTCACCATACTATTTGAAAAATAA
Predicted protein sequences of Glyma01g23662
>Glyma01g23662.1   sequence type=predicted peptide   gene model=Glyma01g23662   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATCKHKYFSGHTRNPDGSVQFIVGKTKVGDAIDGVIKIFTVTVTIVVVAVHEGLPLAMAVVEAWIGGGKKIVDPHDVSQFSRMLCYFVYIPEGGNDVKVSESPTEKAILEWGINYSLNFLACKCQLLYWSLQEDNLVLLAIIGLKDPCLPGVKDAIQLCQKAGVEPLFGKREIGGGERMKFICGVWCEKKRMEIFLKMVGLTILFEK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo