Glyma01g23384 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g23384): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g23384): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g23384

Feature Type:	gene_model
Chromosome:	Gm01
Start:	30079378
stop:	30079787
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g23384

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G28890	AT	Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein \| chr4:14256437-14257735 REVERSE LENGTH=432	SoyBase	E_val: 2.00E-10	ISS
GO:0000041	GO-bp	Annotation by Michelle Graham. GO Biological Process: transition metal ion transport	SoyBase	N/A	ISS
GO:0016567	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein ubiquitination	SoyBase	N/A	ISS
GO:0048527	GO-bp	Annotation by Michelle Graham. GO Biological Process: lateral root development	SoyBase	N/A	ISS
GO:0048589	GO-bp	Annotation by Michelle Graham. GO Biological Process: developmental growth	SoyBase	N/A	ISS
GO:0048765	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation	SoyBase	N/A	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0004842	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PF00097	PFAM	Zinc finger, C3HC4 type (RING finger)	JGI		ISS
UniRef100_G7KB55	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: E3 ubiquitin-protein ligase n=1 Tax=Medicago truncatula RepID=G7KB55_MEDTR	SoyBase	E_val: 8.00E-32	ISS
UniRef100_I1JWB1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JWB1_SOYBN	SoyBase	E_val: 7.00E-77	ISS

Expression Patterns of Glyma01g23384

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g23384 not represented in the dataset	Glyma01g23384 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g23384 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g093800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g23384

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g23384

Limit To All Plant Sequences

>Glyma01g23384.1   sequence type=CDS   gene model=Glyma01g23384   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTGACTAAGTACCTAGCTCCAATTTATACTCATCTCAAATGGGTATTCGATTTTGTTCTCTACTACCCCTTTTACATGCTTTATGATTCTCATCCACCCATAAATCTTGGAACTGAATTGAGTACATTTCATTATGAATTAACCTCTGGCTCAGAGGAACATGTGGATTGTGCTGTGTGTCTAAGCAAATTTGGAGAAAGAGATGAGGTGATTAGAGTTATGAGATGTGAGCATGTCTTCCACAAAGGTTGTTTGGATAGATGGTTGGTTTCAAGAATGCCACAAAGGCCTATCACTAACTCTGGAGCTGAGGTTGTGCTATTTCAGTTTTGTTCTGTCCAAAAGTGTAATGGTGAGACATGGTGGCTACGCTGA

Predicted protein sequences of Glyma01g23384

Limit To All Plant Sequences

>Glyma01g23384.1   sequence type=predicted peptide   gene model=Glyma01g23384   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLTKYLAPIYTHLKWVFDFVLYYPFYMLYDSHPPINLGTELSTFHYELTSGSEEHVDCAVCLSKFGERDEVIRVMRCEHVFHKGCLDRWLVSRMPQRPITNSGAEVVLFQFCSVQKCNGETWWLR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain