Glyma01g23342 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g23342): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g23342): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g23342

Feature Type:	gene_model
Chromosome:	Gm01
Start:	29989094
stop:	29991297
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g23342

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G79810	AT	Annotation by Michelle Graham. TAIR10: Pex2/Pex12 N-terminal domain-containing protein / zinc finger (C3HC4-type RING finger) family protein \| chr1:30020169-30022156 FORWARD LENGTH=282	SoyBase	E_val: 7.00E-85	ISS
GO:0006635	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation	SoyBase	N/A	ISS
GO:0006869	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid transport	SoyBase	N/A	ISS
GO:0006888	GO-bp	Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport	SoyBase	N/A	ISS
GO:0006891	GO-bp	Annotation by Michelle Graham. GO Biological Process: intra-Golgi vesicle-mediated transport	SoyBase	N/A	ISS
GO:0007031	GO-bp	Annotation by Michelle Graham. GO Biological Process: peroxisome organization	SoyBase	N/A	ISS
GO:0009640	GO-bp	Annotation by Michelle Graham. GO Biological Process: photomorphogenesis	SoyBase	N/A	ISS
GO:0010351	GO-bp	Annotation by Michelle Graham. GO Biological Process: lithium ion transport	SoyBase	N/A	ISS
GO:0016558	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix	SoyBase	N/A	ISS
GO:0044265	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular macromolecule catabolic process	SoyBase	N/A	ISS
GO:0005777	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: peroxisome	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR12590	Panther	PEROXISOMAL PROTEIN RELATED	JGI		ISS
PF04757	PFAM	Pex2 / Pex12 amino terminal region	JGI		ISS
UniRef100_G7LFV7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Peroxisome assembly protein n=1 Tax=Medicago truncatula RepID=G7LFV7_MEDTR	SoyBase	E_val: 2.00E-96	ISS
UniRef100_I1KGL4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KGL4_SOYBN	SoyBase	E_val: 7.00E-99	ISS

Expression Patterns of Glyma01g23342

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g23342 not represented in the dataset	Glyma01g23342 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g23342 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g093700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g23342

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g23342

Limit To All Plant Sequences

>Glyma01g23342.1   sequence type=CDS   gene model=Glyma01g23342   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CAAACTGGTATGGAGGGACTTGGACTCACTGTTGCTCAACAACTTTGGTATTGTATTGCCACTATTGGTGGTCAGTATATATGGGCTCTCTTACAATTTTTCTTTGCTTTATGTAGATGGGGTGATACTGAACCATTGGCTAGATGTTTATGGATCTTAATACAACGGATAGAAGGAATACATAGAGCTGCTTCATTTGGAAACCTGTTGATATTTCTTTGCACGGGAAGATATCAAAATCTTATTGAAAGAGCCTTACGAGCTAGGCTTGTATGTAGAAGCCCAAATATGAATCGTGTTGTTAGCTTTGAATATATGAACCGAAAATTAGTTTGGAATGAATTTTTAGAAATGTTATTCCTGCTTCTTCCCTTTCTTAATTCATCATCCGTGAAAAATCTCCTTCGACCTTTTTCTAAAGATAAATCATCAAGTTCAGCTGAGGATGGCACAACATGTCCCATTTGTCAGGCTACTCCCATAATTCCTTATGTTGCCCTACCTTGGCAGCACAAGTATTGTTACTACTGTCTTAGGATATGA

Predicted protein sequences of Glyma01g23342

Limit To All Plant Sequences

>Glyma01g23342.1   sequence type=predicted peptide   gene model=Glyma01g23342   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
QTGMEGLGLTVAQQLWYCIATIGGQYIWALLQFFFALCRWGDTEPLARCLWILIQRIEGIHRAASFGNLLIFLCTGRYQNLIERALRARLVCRSPNMNRVVSFEYMNRKLVWNEFLEMLFLLLPFLNSSSVKNLLRPFSKDKSSSSAEDGTTCPICQATPIIPYVALPWQHKYCYYCLRI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain