SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g23342): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g23342): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g23342

Feature Type:gene_model
Chromosome:Gm01
Start:29989094
stop:29991297
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G79810AT Annotation by Michelle Graham. TAIR10: Pex2/Pex12 N-terminal domain-containing protein / zinc finger (C3HC4-type RING finger) family protein | chr1:30020169-30022156 FORWARD LENGTH=282 SoyBaseE_val: 7.00E-85ISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0006869GO-bp Annotation by Michelle Graham. GO Biological Process: lipid transport SoyBaseN/AISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0006891GO-bp Annotation by Michelle Graham. GO Biological Process: intra-Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0007031GO-bp Annotation by Michelle Graham. GO Biological Process: peroxisome organization SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0010351GO-bp Annotation by Michelle Graham. GO Biological Process: lithium ion transport SoyBaseN/AISS
GO:0016558GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix SoyBaseN/AISS
GO:0044265GO-bp Annotation by Michelle Graham. GO Biological Process: cellular macromolecule catabolic process SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR12590Panther PEROXISOMAL PROTEIN RELATED JGI ISS
PF04757PFAM Pex2 / Pex12 amino terminal region JGI ISS
UniRef100_G7LFV7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peroxisome assembly protein n=1 Tax=Medicago truncatula RepID=G7LFV7_MEDTR SoyBaseE_val: 2.00E-96ISS
UniRef100_I1KGL4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KGL4_SOYBN SoyBaseE_val: 7.00E-99ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g23342 not represented in the dataset

Glyma01g23342 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g093700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g23342.1   sequence type=CDS   gene model=Glyma01g23342   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CAAACTGGTATGGAGGGACTTGGACTCACTGTTGCTCAACAACTTTGGTATTGTATTGCCACTATTGGTGGTCAGTATATATGGGCTCTCTTACAATTTTTCTTTGCTTTATGTAGATGGGGTGATACTGAACCATTGGCTAGATGTTTATGGATCTTAATACAACGGATAGAAGGAATACATAGAGCTGCTTCATTTGGAAACCTGTTGATATTTCTTTGCACGGGAAGATATCAAAATCTTATTGAAAGAGCCTTACGAGCTAGGCTTGTATGTAGAAGCCCAAATATGAATCGTGTTGTTAGCTTTGAATATATGAACCGAAAATTAGTTTGGAATGAATTTTTAGAAATGTTATTCCTGCTTCTTCCCTTTCTTAATTCATCATCCGTGAAAAATCTCCTTCGACCTTTTTCTAAAGATAAATCATCAAGTTCAGCTGAGGATGGCACAACATGTCCCATTTGTCAGGCTACTCCCATAATTCCTTATGTTGCCCTACCTTGGCAGCACAAGTATTGTTACTACTGTCTTAGGATATGA

>Glyma01g23342.1   sequence type=predicted peptide   gene model=Glyma01g23342   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
QTGMEGLGLTVAQQLWYCIATIGGQYIWALLQFFFALCRWGDTEPLARCLWILIQRIEGIHRAASFGNLLIFLCTGRYQNLIERALRARLVCRSPNMNRVVSFEYMNRKLVWNEFLEMLFLLLPFLNSSSVKNLLRPFSKDKSSSSAEDGTTCPICQATPIIPYVALPWQHKYCYYCLRI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo