SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g23300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g23300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g23300

Feature Type:gene_model
Chromosome:Gm01
Start:29947729
stop:29948872
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g23300
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G24610AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: plasma membrane; EXPRESSED IN: 20 plant structures; EXPRESSED DURING: 12 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G65440.1); Has 820 Blast hits to 264 proteins in 74 species: Archae - 0; Bacteria - 15; Metazoa - 77; Fungi - 83; Plants - 96; Viruses - 0; Other Eukaryotes - 549 (source: NCBI BLink). | chr4:12700837-12707899 REVERSE LENGTH=1150 SoyBaseE_val: 1.00E-63ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1JGY7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JGY7_SOYBN SoyBaseE_val: 3.00E-73ISS
UniRef100_Q8RY57UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT5g65440/MNA5_17 n=1 Tax=Arabidopsis thaliana RepID=Q8RY57_ARATH SoyBaseE_val: 9.00E-36ISS

Expression Patterns of Glyma01g23300
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g23300 not represented in the dataset
Glyma01g23300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g23300 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma01g23300
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g23300
>Glyma01g23300.1   sequence type=CDS   gene model=Glyma01g23300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTGCCAAATCTTTCTGCTTCCATATACAGCACAGAGCTTTGCAACAGATTAAGAGCCTTCCTCATATATTGTCCACCAATGGGCCCATCATCACCTGTGGCAGAACTTGTTATTGCCACATCAGATTTTCAGAGATATCTTGTACGCTGGGGTATTGGTTCCATCAAAGGTGGAGTAGATGCAAAAGAGTTGTTCCATTTGTATATTCTTGTTTGGATACAAGATAAACGTCTATCTTTGTTGGAGTCGTGCAAATTAGATAAGGTGAAATGGTCAGGAGTTAGAACACAACATTCTACTACTCCCTTTGTTGATGATATGTATGAGCGGCTGAAGGAGACATTGACAGACTACGAGCACTGGAGTTTTTATTCCTTGATTCTAAGTGTCTTATTGTATGAGATGGACAAAAGATTGAAGGATGACTTTAGACAAACAATATGCGAATGCATTATCTCCTCAAAGAAAGCATGGGTCCTAAGAAATTTGGGCTTAATAAATATGTCCAAAAACTTGCCAAACAATCTACATGTGCCTATGTGGTTCCTGATG
Predicted protein sequences of Glyma01g23300
>Glyma01g23300.1   sequence type=predicted peptide   gene model=Glyma01g23300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VPNLSASIYSTELCNRLRAFLIYCPPMGPSSPVAELVIATSDFQRYLVRWGIGSIKGGVDAKELFHLYILVWIQDKRLSLLESCKLDKVKWSGVRTQHSTTPFVDDMYERLKETLTDYEHWSFYSLILSVLLYEMDKRLKDDFRQTICECIISSKKAWVLRNLGLINMSKNLPNNLHVPMWFLM






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo