|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G41120 | AT | Annotation by Michelle Graham. TAIR10: Esterase/lipase/thioesterase family protein | chr5:16455312-16459198 REVERSE LENGTH=684 | SoyBase | E_val: 7.00E-27 | ISS |
GO:0008152 | GO-bp | Annotation by Michelle Graham. GO Biological Process: metabolic process | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0003824 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: catalytic activity | SoyBase | N/A | ISS |
GO:0016746 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups | SoyBase | N/A | ISS |
GO:0016747 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups | SoyBase | N/A | ISS |
PTHR22753 | Panther | FAMILY NOT NAMED | JGI | ISS | |
PTHR22753:SF5 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
UniRef100_G7KW54 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Acyltransferase-like protein n=1 Tax=Medicago truncatula RepID=G7KW54_MEDTR | SoyBase | E_val: 5.00E-27 | ISS |
UniRef100_UPI000233C037 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233C037 related cluster n=1 Tax=unknown RepID=UPI000233C037 | SoyBase | E_val: 1.00E-40 | ISS |
Glyma01g22927 not represented in the dataset |
Glyma01g22927 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.01g091500 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g22927.1 sequence type=CDS gene model=Glyma01g22927 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCATATACATTATTATATATCCCTTATATATTTGAAATCCAAGAGTGATGCTGGTGGTGAGGTGGTAAATCAGCCAGTGCATATGCCTTTGATTTTGCCTAAAGTTCCTGGTCGGTTCTACTATTATTTTGGAAAACCATTGGAAATGGAAGACGACAGACAAAAATCTCATGAGTTATATTTACAAGTGAAATCTGAGGTTAAGAGATGCATTGCTTATTTAAAGGTGAAAAGAGAAAGCGACCCCTGCAGAGGTATAGGGCCTCGACTATTATACTAG
>Glyma01g22927.1 sequence type=predicted peptide gene model=Glyma01g22927 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MHIHYYISLIYLKSKSDAGGEVVNQPVHMPLILPKVPGRFYYYFGKPLEMEDDRQKSHELYLQVKSEVKRCIAYLKVKRESDPCRGIGPRLLY*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||