Glyma01g22927 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g22927): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g22927): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g22927

Feature Type:	gene_model
Chromosome:	Gm01
Start:	29230775
stop:	29239997
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g22927

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G41120	AT	Annotation by Michelle Graham. TAIR10: Esterase/lipase/thioesterase family protein \| chr5:16455312-16459198 REVERSE LENGTH=684	SoyBase	E_val: 7.00E-27	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0016746	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups	SoyBase	N/A	ISS
GO:0016747	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups	SoyBase	N/A	ISS
PTHR22753	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR22753:SF5	Panther	SUBFAMILY NOT NAMED	JGI		ISS
UniRef100_G7KW54	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Acyltransferase-like protein n=1 Tax=Medicago truncatula RepID=G7KW54_MEDTR	SoyBase	E_val: 5.00E-27	ISS
UniRef100_UPI000233C037	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233C037 related cluster n=1 Tax=unknown RepID=UPI000233C037	SoyBase	E_val: 1.00E-40	ISS

Expression Patterns of Glyma01g22927

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g22927 not represented in the dataset	Glyma01g22927 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g22927 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g091500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g22927

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g22927

Limit To All Plant Sequences

>Glyma01g22927.1   sequence type=CDS   gene model=Glyma01g22927   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATATACATTATTATATATCCCTTATATATTTGAAATCCAAGAGTGATGCTGGTGGTGAGGTGGTAAATCAGCCAGTGCATATGCCTTTGATTTTGCCTAAAGTTCCTGGTCGGTTCTACTATTATTTTGGAAAACCATTGGAAATGGAAGACGACAGACAAAAATCTCATGAGTTATATTTACAAGTGAAATCTGAGGTTAAGAGATGCATTGCTTATTTAAAGGTGAAAAGAGAAAGCGACCCCTGCAGAGGTATAGGGCCTCGACTATTATACTAG

Predicted protein sequences of Glyma01g22927

Limit To All Plant Sequences

>Glyma01g22927.1   sequence type=predicted peptide   gene model=Glyma01g22927   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHIHYYISLIYLKSKSDAGGEVVNQPVHMPLILPKVPGRFYYYFGKPLEMEDDRQKSHELYLQVKSEVKRCIAYLKVKRESDPCRGIGPRLLY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain