|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G66040 | AT | Annotation by Michelle Graham. TAIR10: sulfurtransferase protein 16 | chr5:26410557-26411139 FORWARD LENGTH=120 | SoyBase | E_val: 2.00E-14 | ISS |
| GO:0006569 | GO-bp | Annotation by Michelle Graham. GO Biological Process: tryptophan catabolic process | SoyBase | N/A | ISS |
| GO:0007568 | GO-bp | Annotation by Michelle Graham. GO Biological Process: aging | SoyBase | N/A | ISS |
| GO:0009684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0004792 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: thiosulfate sulfurtransferase activity | SoyBase | N/A | ISS |
| PF00581 | PFAM | Rhodanese-like domain | JGI | ISS | |
| UniRef100_B7FGV4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Senescence-associated protein DIN1 n=1 Tax=Medicago truncatula RepID=B7FGV4_MEDTR | SoyBase | E_val: 5.00E-17 | ISS |
| UniRef100_I1LI75 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LI75_SOYBN | SoyBase | E_val: 1.00E-18 | ISS |
|
Glyma01g22770 not represented in the dataset |
Glyma01g22770 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g22770.1 sequence type=CDS gene model=Glyma01g22770 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high TACGAACTTCTTCTAGCTGGTCATCAATATTTGGATGTAAGGACTCCAGAAGAGTTCAATGCTGGACACGCTCCTGGCGCAATTAACATACCTTATATGTTCAGAGTTGGATCA
>Glyma01g22770.1 sequence type=predicted peptide gene model=Glyma01g22770 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high YELLLAGHQYLDVRTPEEFNAGHAPGAINIPYMFRVGS
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||