SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g22751): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g22751): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g22751

Feature Type:gene_model
Chromosome:Gm01
Start:28847127
stop:28848359
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g22751
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G25655AT Annotation by Michelle Graham. TAIR10: inflorescence deficient in abscission (IDA)-like 1 | chr3:9337709-9337969 REVERSE LENGTH=86 SoyBaseE_val: 1.00E-11ISS
GO:0010227GO-bp Annotation by Michelle Graham. GO Biological Process: floral organ abscission SoyBaseN/AISS
GO:0048765GO-bp Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_Q29PV4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein IDA-LIKE 1 n=1 Tax=Arabidopsis thaliana RepID=IDL1_ARATH SoyBaseE_val: 5.00E-09ISS
UniRef100_UPI00023371BEUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023371BE related cluster n=1 Tax=unknown RepID=UPI00023371BE SoyBaseE_val: 2.00E-62ISS

Expression Patterns of Glyma01g22751
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g22751 not represented in the dataset
Glyma01g22751 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g22751
ParalogEvidenceComments
Glyma02g14821 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g22751 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g090400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g22751
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g22751
>Glyma01g22751.1   sequence type=CDS   gene model=Glyma01g22751   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAATTACCATTCTTCTAAATCCTTGCATCTTCCATGCAAAACCTTATCTCTAGTTCTCCTTTTTGTTTACTTGCTACTTATTGGTTCTTGTGATGCAATAAGAATAGGCCAAACTATGAAGCTGAATGAAACAAGAGAGATTCTCAAGAGAAAGCGCAATAACCAACATGGTTTTCCATACAAAAGCATGGTTTTCAACTTCTTCCCCAAAGGGCCGGTGCCACCTTCAGGTCCTTCAAAGAGGCATAACGCAGTGGTGGATTCAACACCTAATAATTGA
Predicted protein sequences of Glyma01g22751
>Glyma01g22751.1   sequence type=predicted peptide   gene model=Glyma01g22751   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANYHSSKSLHLPCKTLSLVLLFVYLLLIGSCDAIRIGQTMKLNETREILKRKRNNQHGFPYKSMVFNFFPKGPVPPSGPSKRHNAVVDSTPNN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo