Glyma01g22554 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g22554): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g22554): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g22554

Feature Type:	gene_model
Chromosome:	Gm01
Start:	28393069
stop:	28396339
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g22554

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G18710	AT	Annotation by Michelle Graham. TAIR10: Protein kinase superfamily protein \| chr4:10296474-10301148 FORWARD LENGTH=280	SoyBase	E_val: 5.00E-11	ISS
GO:0006096	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycolysis	SoyBase	N/A	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0006833	GO-bp	Annotation by Michelle Graham. GO Biological Process: water transport	SoyBase	N/A	ISS
GO:0006972	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic response	SoyBase	N/A	ISS
GO:0007030	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi organization	SoyBase	N/A	ISS
GO:0009266	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009729	GO-bp	Annotation by Michelle Graham. GO Biological Process: detection of brassinosteroid stimulus	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0009742	GO-bp	Annotation by Michelle Graham. GO Biological Process: brassinosteroid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009825	GO-bp	Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth	SoyBase	N/A	ISS
GO:0009965	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0046777	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation	SoyBase	N/A	ISS
GO:0046827	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of protein export from nucleus	SoyBase	N/A	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0004713	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
UniRef100_E4MVH8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: mRNA, clone: RTFL01-02-M08 n=1 Tax=Eutrema halophilum RepID=E4MVH8_THEHA	SoyBase	E_val: 5.00E-08	ISS
UniRef100_UPI00023371B8	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00023371B8 related cluster n=1 Tax=unknown RepID=UPI00023371B8	SoyBase	E_val: 1.00E-11	ISS

Expression Patterns of Glyma01g22554

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g22554 not represented in the dataset	Glyma01g22554 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g22554 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g088500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g22554

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g22554

Limit To All Plant Sequences

>Glyma01g22554.1   sequence type=CDS   gene model=Glyma01g22554   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGGAAAAGATGTTTTACTTTCCCACCCTAGTCTCCACCTTGATTGATATATACTATTCAATTGAAGGTTTGGTTCTTATAAAGGAAATGCCAACTCTTGTTGCAGATGGTAATGATGCACTCACTGGTCACATAATCTCAACCACAATTTCAGGCAAAAATGGCGAACCTAAACAAGTGCAGCGTGTTCTAACCTTTCTTTACTTCCAATTTTTATTAAAAAAAAATCATTTTGTACTATATATACATATTTACTTCCTTTTTGAAACTAACAGGAACTACATTGTGGTTTTGGGTAGTAAACCTTTTAATTATGGATCCATCCAAAAATATAATATTGGTAGTCAGCTAGAAGTTGGCAAATTTCCTCTATGCTTATCTAATCTAATTGCTTTTTTTTTTTTTAATTTAATTTTGTTCTCCCCCTTCCATTGA

Predicted protein sequences of Glyma01g22554

Limit To All Plant Sequences

>Glyma01g22554.1   sequence type=predicted peptide   gene model=Glyma01g22554   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVEKMFYFPTLVSTLIDIYYSIEGLVLIKEMPTLVADGNDALTGHIISTTISGKNGEPKQVQRVLTFLYFQFLLKKNHFVLYIHIYFLFETNRNYIVVLGSKPFNYGSIQKYNIGSQLEVGKFPLCLSNLIAFFFFNLILFSPFH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain