Glyma01g22542 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g22542): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g22542): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g22542

Feature Type:	gene_model
Chromosome:	Gm01
Start:	28390588
stop:	28392968
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g22542

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G30980	AT	Annotation by Michelle Graham. TAIR10: SHAGGY-related protein kinase dZeta \| chr2:13182350-13185870 REVERSE LENGTH=412	SoyBase	E_val: 3.00E-43	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0009742	GO-bp	Annotation by Michelle Graham. GO Biological Process: brassinosteroid mediated signaling pathway	SoyBase	N/A	ISS
GO:0032880	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of protein localization	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
PTHR24057	Panther	GLYCOGEN SYNTHASE KINASE-3 ALPHA	JGI		ISS
PTHR24057:SF114	Panther		JGI		ISS
PF00069	PFAM	Protein kinase domain	JGI		ISS
UniRef100_G5DXN5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Shaggy-like protein kinase (Fragment) n=1 Tax=Silene latifolia RepID=G5DXN5_SILLA	SoyBase	E_val: 2.00E-41	ISS
UniRef100_UPI00023371B8	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI00023371B8 related cluster n=1 Tax=unknown RepID=UPI00023371B8	SoyBase	E_val: 1.00E-53	ISS

Expression Patterns of Glyma01g22542

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g22542 not represented in the dataset	Glyma01g22542 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g22542 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma01g22542

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g22542

Limit To All Plant Sequences

>Glyma01g22542.1   sequence type=CDS   gene model=Glyma01g22542   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACTTTTTTCTGAACTTGGTGATGGAATATGTCCCTGAGACGATCTTCCGTGTTATAAAGCACTACAGTAGCATGAAACAGAGAATTCCCCTAATCTATGTGAAATTATATACATATCAAATCTTTAGGGGACTGGCGTATATCCATACTGCACCAGGAATCTACCATAGACATGTGAAGCCTCAAAATCTTTTGATTGATCGACTCATACACCAAGTCAAGCTCTGCGATTTTGGGAGTGCAAAAGTTCTGATATTTTGA

Predicted protein sequences of Glyma01g22542

Limit To All Plant Sequences

>Glyma01g22542.1   sequence type=predicted peptide   gene model=Glyma01g22542   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNFFLNLVMEYVPETIFRVIKHYSSMKQRIPLIYVKLYTYQIFRGLAYIHTAPGIYHRHVKPQNLLIDRLIHQVKLCDFGSAKVLIF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain