Glyma01g22210 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g22210

Feature Type:	gene_model
Chromosome:	Gm01
Start:	27837984
stop:	27840530
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g22210

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G23780	AT	Annotation by Michelle Graham. TAIR10: F-box family protein \| chr1:8407053-8408480 REVERSE LENGTH=475	SoyBase	E_val: 5.00E-13	ISS
GO:0006635	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation	SoyBase	N/A	ISS
GO:0016558	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
UniRef100_E5GBH4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: F-box family protein n=1 Tax=Cucumis melo subsp. melo RepID=E5GBH4_CUCME	SoyBase	E_val: 2.00E-20	ISS
UniRef100_I1NG44	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NG44_SOYBN	SoyBase	E_val: 6.00E-102	ISS

Expression Patterns of Glyma01g22210

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g22210 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g087400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g22210

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g22210

Limit To All Plant Sequences

>Glyma01g22210.1   sequence type=CDS   gene model=Glyma01g22210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGCAGCTAGCTCATCATCAACAGCGCCTTCTCCTGGCCTATGCACAATTCCACATTTATCACAGACTCCTCGACCTCGTAAGTCCTCCTTCCTCAAAATCGAAGTCCCCGATTCCTGTTCTCTGCTGCAACTCAAAGACACTGTTCCTCGCACCATCTCTTCTTCTTCCTCTTCTCTACATCTTTCCCTCAACAGAAAGGATAAAATTCACGCCCCTTCGCAGGAAGAGCCCCTCAACTCTCTCGGTGTCGCCATCGGCAACCTCATCTTCTACTCTCTCAACCCTACCGTCTTCACCCTTGAAACCCTCCTGCACAAGCCAGAAACCGCTCCTCGTGATGGACCCACCATCCAAGACTCATCGGAAACCCTCACCAGTGACTCCCCCTTCGTTCTAGACGCCGAAAAGCCTCCGACTTTAGATGCCGCGGAACTGGAATCCATGGAAATGATTGATGGGTCTGACGAGACGGTGGTGGTGGGTACCAATTCCGAGCCTTTCTTCATGAGAAGGGTTTTGAAAGAAGCGCCTGGGAACAACGTTAATGATTTCAAGTTATTAGTGTTTATGGTTCATGGTGTTGATTCTGGTATGGCGTTTAGTGGTTCTCACCTTCTTGATGATTCTCCTCCGACTTTTTCTTCGATGATATCTTTGAGGTATACCCTGCTTGACATTCTGGCTAATGGTGATTCTCACAATATATATCATACAAAGTTGAACTGCAACGTTAATCATGTGTTTCCCCTGCTAGCTTTCAGAGGCACCAGATTGGACATTTATGAGAGAAAGGAAGGCTCAAATGGCATTTTTATTTGGATTTGA

Predicted protein sequences of Glyma01g22210

Limit To All Plant Sequences

>Glyma01g22210.1   sequence type=predicted peptide   gene model=Glyma01g22210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVAASSSSTAPSPGLCTIPHLSQTPRPRKSSFLKIEVPDSCSLLQLKDTVPRTISSSSSSLHLSLNRKDKIHAPSQEEPLNSLGVAIGNLIFYSLNPTVFTLETLLHKPETAPRDGPTIQDSSETLTSDSPFVLDAEKPPTLDAAELESMEMIDGSDETVVVGTNSEPFFMRRVLKEAPGNNVNDFKLLVFMVHGVDSGMAFSGSHLLDDSPPTFSSMISLRYTLLDILANGDSHNIYHTKLNCNVNHVFPLLAFRGTRLDIYERKEGSNGIFIWI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain