Report for Sequence Feature Glyma01g21870
Feature Type: gene_model
Chromosome: Gm01
Start: 27283471
stop: 27283944
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Expression Patterns of Glyma01g21870
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma01g21870 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma01g21870
Coding sequences of Glyma01g21870
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma01g21870.1 sequence type=CDS gene model=Glyma01g21870 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGGAAAGGCAGTAAACAAGAATGTGTTTGCGGTGGTTTGTGCGGAATCGATAGCGAGCCATACAGCGGGGACAACGCGTTCCGTTCTTGGAACCAAAAGTTCTCTGTGGAGTTGGGGCAGCACGCGAGGCACGTGACGATTGAGGTGAAGTAA
Predicted protein sequences of Glyma01g21870
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma01g21870.1 sequence type=predicted peptide gene model=Glyma01g21870 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGKGSKQECVCGGLCGIDSEPYSGDNAFRSWNQKFSVELGQHARHVTIEVK*