Glyma01g21000 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g21000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g21000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g21000

Feature Type:	gene_model
Chromosome:	Gm01
Start:	26227618
stop:	26228265
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g21000

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G30690	AT	Annotation by Michelle Graham. TAIR10: Translation initiation factor 3 protein \| chr4:14960742-14962328 FORWARD LENGTH=253	SoyBase	E_val: 2.00E-13	ISS
GO:0006413	GO-bp	Annotation by Michelle Graham. GO Biological Process: translational initiation	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003743	GO-mf	Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity	SoyBase	N/A	ISS
PF05198	PFAM	Translation initiation factor IF-3, N-terminal domain	JGI		ISS
UniRef100_I1JGR6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Translation initiation factor IF-3 n=1 Tax=Glycine max RepID=I1JGR6_SOYBN	SoyBase	E_val: 5.00E-42	ISS
UniRef100_UPI000233755F	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233755F related cluster n=1 Tax=unknown RepID=UPI000233755F	SoyBase	E_val: 3.00E-42	ISS

Expression Patterns of Glyma01g21000

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g21000 not represented in the dataset	Glyma01g21000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g21000 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g084100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g21000

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g21000

Limit To All Plant Sequences

>Glyma01g21000.1   sequence type=CDS   gene model=Glyma01g21000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGGCATCACAACCTTCTCCTTCAAACTCTCTCATTGTCCTCTCTTCTCTACTTCCGATTCCAAACTCTTCGGCCTTCCCCTCTCCAATCCCTATTCCATCAAATTCGACCCTTCTTCTCTCTCCAATACCTCTCTCTCCTACGTCACTGCCCGCTACTACGGTGGCAGCGGCGGCGCCTCTCCCCGCTCCCCCAATGACCCCCGCTCCCGCAAGTCCTTCGATTCTGACGACGACGATAAAGCTCTCGACCTTTCCACTCTCAGGCTTATTGATCAGAGCCAGAATATGGTTGGAGTAGTGTCAATCGATGACGCCATTGAAATGGCTGAAGATGTCGAACTTGACTTGGTATGA

Predicted protein sequences of Glyma01g21000

Limit To All Plant Sequences

>Glyma01g21000.1   sequence type=predicted peptide   gene model=Glyma01g21000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVGITTFSFKLSHCPLFSTSDSKLFGLPLSNPYSIKFDPSSLSNTSLSYVTARYYGGSGGASPRSPNDPRSRKSFDSDDDDKALDLSTLRLIDQSQNMVGVVSIDDAIEMAEDVELDLV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain