SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g20720): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g20720): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g20720

Feature Type:gene_model
Chromosome:Gm01
Start:25343081
stop:25358309
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G25860AT Annotation by Michelle Graham. TAIR10: 2-oxoacid dehydrogenases acyltransferase family protein | chr3:9460632-9462585 FORWARD LENGTH=480 SoyBaseE_val: 0ISS
GO:0000096GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process SoyBaseN/AISS
GO:0006084GO-bp Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process SoyBaseN/AISS
GO:0006086GO-bp Annotation by Michelle Graham. GO Biological Process: acetyl-CoA biosynthetic process from pyruvate SoyBaseN/AISS
GO:0006546GO-bp Annotation by Michelle Graham. GO Biological Process: glycine catabolic process SoyBaseN/AISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0006733GO-bp Annotation by Michelle Graham. GO Biological Process: oxidoreduction coenzyme metabolic process SoyBaseN/AISS
GO:0006766GO-bp Annotation by Michelle Graham. GO Biological Process: vitamin metabolic process SoyBaseN/AISS
GO:0007020GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule nucleation SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0008652GO-bp Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process SoyBaseN/AISS
GO:0009072GO-bp Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family metabolic process SoyBaseN/AISS
GO:0009106GO-bp Annotation by Michelle Graham. GO Biological Process: lipoate metabolic process SoyBaseN/AISS
GO:0009108GO-bp Annotation by Michelle Graham. GO Biological Process: coenzyme biosynthetic process SoyBaseN/AISS
GO:0009117GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0016126GO-bp Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process SoyBaseN/AISS
GO:0016132GO-bp Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019748GO-bp Annotation by Michelle Graham. GO Biological Process: secondary metabolic process SoyBaseN/AISS
GO:0044272GO-bp Annotation by Michelle Graham. GO Biological Process: sulfur compound biosynthetic process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0004742GO-mf Annotation by Michelle Graham. GO Molecular Function: dihydrolipoyllysine-residue acetyltransferase activity SoyBaseN/AISS
GO:0016746GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups SoyBaseN/AISS
KOG0557 KOG Dihydrolipoamide acetyltransferase JGI ISS
PTHR23151Panther DIHYDROLIPOAMIDE ACETYL/SUCCINYL-TRANSFERASE-RELATED JGI ISS
PTHR23151:SF31Panther SUBFAMILY NOT NAMED JGI ISS
PF00198PFAM 2-oxoacid dehydrogenases acyltransferase (catalytic domain) JGI ISS
PF00364PFAM Biotin-requiring enzyme JGI ISS
PF02817PFAM e3 binding domain JGI ISS
UniRef100_I1J6K8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1J6K8_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q9SQI8UniRef Annotation by Michelle Graham. Most informative UniRef hit: 2-oxoacid dehydrogenases acyltransferase family protein n=3 Tax=Arabidopsis thaliana RepID=Q9SQI8_ARATH SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g20720 not represented in the dataset

Glyma01g20720 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g081900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g20720.1   sequence type=CDS   gene model=Glyma01g20720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCGCCCTTTCTCCCCGCCAAAACCAATTCCGCCACCCTCTCCTTCTCCGCCGCAGTCCCCGGCCGCCGCCTCCACTTCGCGGCGTCTCCGTCGCATTCCCCTCGACGGAGGTCCTCCCTGACGGTGAAGTCGAAGATCAGGGAGATCTTCATGCCCGCCCTCAGCTCCACCATGACGGAGGGAAAAATCGTCTCGTGGGTCAAGTCCGAGGGCGACGTCCTCTCCAAAGGTGACAGCGTCGTCGTCGTCGAGTCCGACAAGGCCGACATGGACGTCGAGACGTTCTACAATGGCATCCTCGCCGTCATCGTTGTCGCCGAGGGCCAGACCGCCCCCGTCGGTGCCCCCATCGGCCTCCTTGCGGAGACCGAGGCCGAAGTTGCCGAGGCCATGGCAGCCGCCAATTCTGCTCCAACTCCACCTCCCAAAGCTTCCGATACTTCTCCGGCGCCGGCACCGGCGCCGGAAGTCTCTGATTCACCACGTAAGGCGGTTGCAACACCGTATGCCAAGAAGCTCGCGAAGCAGCACAAAGTGAACATAGGTTCGGTTGTCGGGACTGGTCCGTTTGGAAGAGTCACTCCTGCTGACGTGGAGAAGGCCGCCGGTATTTTGCCGGCGGAGAGCAATGTAGCTCCGGCGGCGGTGGATTCGGCTCCACCGAAAGCTGCTGCTGCGGCTCCGGCGGCATCCTCGGCTTCAATTCCAGGTTCTAGTGTTGTGGCCTTTACGACAATGCAATCTGCGGTTGCGAAGAACATGGTGGAGAGTCTCTCTGTGCCGACGTTCCGTGTTGGGTACCCAGTTACCACTGATGCACTTGATGCTCTGTATGAGAAGGTGAGAAAAAAGGGTGTGACCATGACAGCGATTCTGGCCAAGGCAGCTGCAATGGCACTCGTTCAGCACCCAGTGGTGAATGCCTCGTGCAAAGATGGGAAGAACTTTGCCTATAATAGTAACATTAACATTGCTGTTGCTGTGGCAACCAATGGTGGTTTGATTACACCGGTTCTTCAGGATGCAGATAAGTTGGACTTGTATCTTTTGTCCCAAAAATGGAAAGAACTAGTGGAAAAAGCTCGTGCCAAGCAATTGCAACCTCATGAATATAATTCAGGAACTTTCACACTTTCAAATTTGGGAATGTTTGGAGTTGACAGGTTTGACGCCATACTTCCTCCAGGCCAGGGGGCTATCATGGCGGTTGGAGCATCAAAACCTACTGTCCTAGCAGATAAGGATGGTTTCTTTACTGTAAAAAGTAAAATGCTGGTAAATGTAACTGCTGATCACCGAATAATCTATGGGGCTGACTTGGCTGCATTCCTTCAGACATTCTCAAAAATCATTGAGAACCCTGAATGCCTAACATTGTAG

>Glyma01g20720.1   sequence type=predicted peptide   gene model=Glyma01g20720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASPFLPAKTNSATLSFSAAVPGRRLHFAASPSHSPRRRSSLTVKSKIREIFMPALSSTMTEGKIVSWVKSEGDVLSKGDSVVVVESDKADMDVETFYNGILAVIVVAEGQTAPVGAPIGLLAETEAEVAEAMAAANSAPTPPPKASDTSPAPAPAPEVSDSPRKAVATPYAKKLAKQHKVNIGSVVGTGPFGRVTPADVEKAAGILPAESNVAPAAVDSAPPKAAAAAPAASSASIPGSSVVAFTTMQSAVAKNMVESLSVPTFRVGYPVTTDALDALYEKVRKKGVTMTAILAKAAAMALVQHPVVNASCKDGKNFAYNSNINIAVAVATNGGLITPVLQDADKLDLYLLSQKWKELVEKARAKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASKPTVLADKDGFFTVKSKMLVNVTADHRIIYGADLAAFLQTFSKIIENPECLTL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo