Glyma01g19200 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g19200

Feature Type:	gene_model
Chromosome:	Gm01
Start:	23586982
stop:	23590259
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g19200

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G68260	AT	Annotation by Michelle Graham. TAIR10: Thioesterase superfamily protein \| chr1:25585976-25587601 REVERSE LENGTH=190	SoyBase	E_val: 4.00E-89	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0019344	GO-bp	Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process	SoyBase	N/A	ISS
GO:0016788	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds	SoyBase	N/A	ISS
GO:0047617	GO-mf	Annotation by Michelle Graham. GO Molecular Function: acyl-CoA hydrolase activity	SoyBase	N/A	ISS
PF03061	PFAM	Thioesterase superfamily	JGI		ISS
UniRef100_G7K1I9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Thioesterase-like protein n=1 Tax=Medicago truncatula RepID=G7K1I9_MEDTR	SoyBase	E_val: 2.00E-109	ISS
UniRef100_I1J6J3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J6J3_SOYBN	SoyBase	E_val: 3.00E-147	ISS

Expression Patterns of Glyma01g19200

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g19200 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g080400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g19200

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g19200

Limit To All Plant Sequences

>Glyma01g19200.2   sequence type=CDS   gene model=Glyma01g19200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCTACAACCACACTTCCTCGATGTCATTGCCTTCCCCATTGTACCTGAATACTACGTCGTTTCGCCTCACGCGCCAATCTCCTTTTCCTTTTCCCCGCCGGCGCTTCAATCCACCGGCTTTCCGATCAGTTTCGCCGTTGAGTTCCAGCCCCTCTGCATCACTCTTCGATCTCAGAGGGGGCAAAGGAATGAGTGGATTCCATGACGTTGAACTGAAGGTGCGCGACTATGAGTTGGATCAGTACGGTGTGGTTAACAATGCAGTTTATGCTAGTTATTGCCAGCACGGTCGTCATGAACTCTTGCAAAACATTGGTATTAATTGCGATGCTGTGGCTCGCAGTGGTGATGCATTGGCATTGTCTGAACTATCGCTCAAATTCCTTGCACCTCTAAGAAGTGGAGACAAATTTGTTGTAAGAGTTAGGATTTCTGGCTCTTCAGCTGCTCGTTTATACTTTGATCACTTCATCTATAAGCTGCCAAACCAAGAGCCTATTTTGGAAGCCAAGGCCATAGCGGTGTGGCTTGACAAAAACTATCGTCCTATACGAATTCCAGCAGAGATGAAGTCTAAATTTGTAAAGTTTATTCGAATTGAGGACTCTTAA

Predicted protein sequences of Glyma01g19200

Limit To All Plant Sequences

>Glyma01g19200.2   sequence type=predicted peptide   gene model=Glyma01g19200   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLYNHTSSMSLPSPLYLNTTSFRLTRQSPFPFPRRRFNPPAFRSVSPLSSSPSASLFDLRGGKGMSGFHDVELKVRDYELDQYGVVNNAVYASYCQHGRHELLQNIGINCDAVARSGDALALSELSLKFLAPLRSGDKFVVRVRISGSSAARLYFDHFIYKLPNQEPILEAKAIAVWLDKNYRPIRIPAEMKSKFVKFIRIEDS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain