SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g18990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g18990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g18990

Feature Type:gene_model
Chromosome:Gm01
Start:23424892
stop:23425203
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G01370AT Annotation by Michelle Graham. TAIR10: CRM family member 2 | chr3:139033-143477 FORWARD LENGTH=1011 SoyBaseE_val: 4.00E-11ISS
GO:0000372GO-bp Annotation by Michelle Graham. GO Biological Process: Group I intron splicing SoyBaseN/AISS
GO:0000373GO-bp Annotation by Michelle Graham. GO Biological Process: Group II intron splicing SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
UniRef100_B9GHP2UniRef Annotation by Michelle Graham. Best UniRef hit: Predicted protein n=1 Tax=Populus trichocarpa RepID=B9GHP2_POPTR SoyBaseE_val: 4.00E-13ISS
UniRef100_G7KJD3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chloroplastic group IIA intron splicing facilitator CRS1 n=1 Tax=Medicago truncatula RepID=G7KJD3_MEDTR SoyBaseE_val: 2.00E-11ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g18990 not represented in the dataset

Glyma01g18990 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g18990.1   sequence type=CDS   gene model=Glyma01g18990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCCGCCATTGAACGAATCGCCAAGAAGCTCCACAGCCTCGGCATCACCGAACCCCTTACCTCCTCCTCTGAAATTCACGTTCTGTTCCCGCATGATCTCCCAAAGCGGCACGTGGGGCACACCTTCGAGCCTAGGTGTAGCATGCCGCTGAAACCGATGCCGGTCCCAGGGACCGACATCGCGGCGCTGAGCAAGAGCGAGGTGATGAGGCAAAAGAAACTGCGTGCAGAGGAGTCAAGGAGGAGGAAAGAATTGGTGCTGACCCTGGTGGAGCTGAGCCTCTCGGACTCAGAGATTTGGCACCTGACCACG

>Glyma01g18990.1   sequence type=predicted peptide   gene model=Glyma01g18990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SAIERIAKKLHSLGITEPLTSSSEIHVLFPHDLPKRHVGHTFEPRCSMPLKPMPVPGTDIAALSKSEVMRQKKLRAEESRRRKELVLTLVELSLSDSEIWHLTT







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo