|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G33470 | AT | Annotation by Michelle Graham. TAIR10: RNA-binding (RRM/RBD/RNP motifs) family protein | chr1:12144632-12146040 FORWARD LENGTH=245 | SoyBase | E_val: 2.00E-32 | ISS |
| GO:0000398 | GO-bp | Annotation by Michelle Graham. GO Biological Process: mRNA splicing, via spliceosome | SoyBase | N/A | ISS |
| GO:0006810 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transport | SoyBase | N/A | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0003676 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding | SoyBase | N/A | ISS |
| GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS |
| PTHR24011 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR24011:SF26 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| PF00076 | PFAM | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) | JGI | ISS | |
| UniRef100_B9R8Y3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: RNA-binding region-containing protein, putative n=1 Tax=Ricinus communis RepID=B9R8Y3_RICCO | SoyBase | E_val: 3.00E-36 | ISS |
| UniRef100_I1J6F5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1J6F5_SOYBN | SoyBase | E_val: 2.00E-47 | ISS |
|
Glyma01g15802 not represented in the dataset |
Glyma01g15802 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.01g076600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g15802.1 sequence type=CDS gene model=Glyma01g15802 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAGTACTATTTTGAGCAATTTGGTGAGATCTTGGAGGCTGTTGTCATCTCTAACAAAGCCATTGGAAGATCTAAAGGCTATGGATATGTTACTTTTCGTGAACCAGAAGCTGCCATGAGAGCTTGTATGGATCCTGCTCCTGTAATCGACTGTAGGAGAGCTAACTACAACCTTGCTTCTTTGGGTGTCCAGAGATCTAGGCCTTCAACCGCAAAACATGCTAATCTATAA
>Glyma01g15802.1 sequence type=predicted peptide gene model=Glyma01g15802 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKYYFEQFGEILEAVVISNKAIGRSKGYGYVTFREPEAAMRACMDPAPVIDCRRANYNLASLGVQRSRPSTAKHANL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||