SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g15382): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g15382): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g15382

Feature Type:gene_model
Chromosome:Gm01
Start:18694962
stop:18695204
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG00180AT Annotation by Michelle Graham. TAIR10: DNA-directed RNA polymerase family protein | chrC:20251-23084 REVERSE LENGTH=680 SoyBaseE_val: 5.00E-38ISS
GO:0006091GO-bp Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy SoyBaseN/AISS
GO:0006351GO-bp Annotation by Michelle Graham. GO Biological Process: transcription, DNA-dependent SoyBaseN/AISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0009295GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleoid SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003899GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA-directed RNA polymerase activity SoyBaseN/AISS
PTHR19376Panther DNA-DIRECTED RNA POLYMERASE JGI ISS
PTHR19376:SF4Panther DNA-DIRECTED RNA POLYMERASE JGI ISS
PF00623PFAM RNA polymerase Rpb1, domain 2 JGI ISS
UniRef100_G8D705UniRef Annotation by Michelle Graham. Most informative UniRef hit: DNA-directed RNA polymerase (Fragment) n=2 Tax=Asarum RepID=G8D705_ASACA SoyBaseE_val: 2.00E-38ISS
UniRef100_G8D705UniRef Annotation by Michelle Graham. Best UniRef hit: DNA-directed RNA polymerase (Fragment) n=2 Tax=Asarum RepID=G8D705_ASACA SoyBaseE_val: 2.00E-38ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g15382 not represented in the dataset

Glyma01g15382 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g076000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g15382.1   sequence type=CDS   gene model=Glyma01g15382   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGGACGTTCATAATAAGGTTTACAAATCATTTTCTGATATAATTGAGGGCAAAGAGGGAAGATTTCACGAGACTCTACTTGGTAAACGGGTTGATTATTCGGGTCGTTCTGTCATTGTCGTAGGTCCATCAGTTTCATTACATAGATGTGGATTGCCCCGCGAAATAGCAATAGAACTTTTCCAGACATTTCTAATTCGTGGTGTAAATTAA

>Glyma01g15382.1   sequence type=predicted peptide   gene model=Glyma01g15382   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRDVHNKVYKSFSDIIEGKEGRFHETLLGKRVDYSGRSVIVVGPSVSLHRCGLPREIAIELFQTFLIRGVN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo