SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g13960

Feature Type:gene_model
Chromosome:Gm01
Start:17481712
stop:17482061
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g13960
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G20570AT Annotation by Michelle Graham. TAIR10: RING-box 1 | chr5:6956905-6958221 REVERSE LENGTH=118 SoyBaseE_val: 6.00E-22ISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0016925GO-bp Annotation by Michelle Graham. GO Biological Process: protein sumoylation SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0042752GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of circadian rhythm SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0051510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0019005GO-cc Annotation by Michelle Graham. GO Cellular Compartment: SCF ubiquitin ligase complex SoyBaseN/AISS
GO:0031463GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Cul3-RING ubiquitin ligase complex SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR11210Panther RING FINGER JGI ISS
UniRef100_A0ELV2UniRef Annotation by Michelle Graham. Most informative UniRef hit: RBX1-like protein n=1 Tax=Petunia integrifolia subsp. inflata RepID=A0ELV2_PETIN SoyBaseE_val: 6.00E-28ISS
UniRef100_I1J6E1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J6E1_SOYBN SoyBaseE_val: 1.00E-45ISS

Expression Patterns of Glyma01g13960
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g13960 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g073300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g13960
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g13960
>Glyma01g13960.2   sequence type=CDS   gene model=Glyma01g13960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGACTCTAGATTTCGACGTTCCTATGGTTCCTACCGGCGAGCCCTCAAGTAACGTCGGTCCTTCTTCCAAGAAGCCCAAGCACTTCGAGATCAAGAAGTGGAACGTCGTCACTCTCTGGGCTTGGGACATCGTTGTCGATAACTGTGCTATATGTTGGAACCACATCATGGATCTCTGTAAGAAATTTCACTTTTTCCAATTGAAAACAGTTCTTTTATTTGAAGCATTTCGTTCCGCTTCTTGA
Predicted protein sequences of Glyma01g13960
>Glyma01g13960.2   sequence type=predicted peptide   gene model=Glyma01g13960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATLDFDVPMVPTGEPSSNVGPSSKKPKHFEIKKWNVVTLWAWDIVVDNCAICWNHIMDLCKKFHFFQLKTVLLFEAFRSAS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo