SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g12310): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g12310): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g12310

Feature Type:gene_model
Chromosome:Gm01
Start:15500344
stop:15500912
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G36360AT Annotation by Michelle Graham. TAIR10: beta-galactosidase 3 | chr4:17176840-17181143 REVERSE LENGTH=855 SoyBaseE_val: 1.00E-31ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0005990GO-bp Annotation by Michelle Graham. GO Biological Process: lactose catabolic process SoyBaseN/AISS
GO:0006598GO-bp Annotation by Michelle Graham. GO Biological Process: polyamine catabolic process SoyBaseN/AISS
GO:0009664GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization SoyBaseN/AISS
GO:0009698GO-bp Annotation by Michelle Graham. GO Biological Process: phenylpropanoid metabolic process SoyBaseN/AISS
GO:0009832GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0019513GO-bp Annotation by Michelle Graham. GO Biological Process: lactose catabolic process, using glucoside 3-dehydrogenase SoyBaseN/AISS
GO:0019515GO-bp Annotation by Michelle Graham. GO Biological Process: lactose catabolic process via UDP-galactose SoyBaseN/AISS
GO:0042398GO-bp Annotation by Michelle Graham. GO Biological Process: cellular modified amino acid biosynthetic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
GO:0004565GO-mf Annotation by Michelle Graham. GO Molecular Function: beta-galactosidase activity SoyBaseN/AISS
GO:0030246GO-mf Annotation by Michelle Graham. GO Molecular Function: carbohydrate binding SoyBaseN/AISS
GO:0043169GO-mf Annotation by Michelle Graham. GO Molecular Function: cation binding SoyBaseN/AISS
PTHR23421Panther BETA-GALACTOSIDASE RELATED JGI ISS
PTHR23421:SF2Panther BETA-GALACTOSIDASE JGI ISS
PF01301PFAM Glycosyl hydrolases family 35 JGI ISS
UniRef100_I1JCK7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Beta-galactosidase n=1 Tax=Glycine max RepID=I1JCK7_SOYBN SoyBaseE_val: 2.00E-38ISS
UniRef100_I1JCK7UniRef Annotation by Michelle Graham. Best UniRef hit: Beta-galactosidase n=1 Tax=Glycine max RepID=I1JCK7_SOYBN SoyBaseE_val: 2.00E-38ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g12310 not represented in the dataset

Glyma01g12310 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g12310.1   sequence type=CDS   gene model=Glyma01g12310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGTAAGTTGCAAGGAGCTGCTGGTCAAAACTATGTGAATTGGGCTGCAAAAATGGTTGTGGAAATGGGAACTGGGGTCCCTTGGGTGATGTGCAAGGAAGACGATGCACCAGATCCAGTGATAAACACATACTATGGCTTCTATTGTCATAAATTTACTCCAAATAGACCCTATAAGCCTATGATTTGGACAGAGGCTTGGAGTGGCTGGAAGGTTTACCGAATTTGGAGGTCCAATTCACAAAAGACC

>Glyma01g12310.1   sequence type=predicted peptide   gene model=Glyma01g12310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SKLQGAAGQNYVNWAAKMVVEMGTGVPWVMCKEDDAPDPVINTYYGFYCHKFTPNRPYKPMIWTEAWSGWKVYRIWRSNSQKT







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo