SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g11640): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g11640): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g11640

Feature Type:gene_model
Chromosome:Gm01
Start:14972819
stop:14973806
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G73260AT Annotation by Michelle Graham. TAIR10: kunitz trypsin inhibitor 1 | chr1:27547410-27548057 REVERSE LENGTH=215 SoyBaseE_val: 3.00E-21ISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0012501GO-bp Annotation by Michelle Graham. GO Biological Process: programmed cell death SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0004866GO-mf Annotation by Michelle Graham. GO Molecular Function: endopeptidase inhibitor activity SoyBaseN/AISS
PF00197PFAM Trypsin and protease inhibitor JGI ISS
UniRef100_C6T3I9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T3I9_SOYBN SoyBaseE_val: 1.00E-150ISS
UniRef100_P01070UniRef Annotation by Michelle Graham. Most informative UniRef hit: Trypsin inhibitor A n=1 Tax=Glycine max RepID=ITRA_SOYBN SoyBaseE_val: 8.00E-71ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g11640 not represented in the dataset

Glyma01g11640 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g096200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g11640.1   sequence type=CDS   gene model=Glyma01g11640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGAGCTCTACCTTGTTCGCTCTCTTTCTACTTTCTGCCATCTTCACCTCATACCTACCTTCTGCAACCGCTGATGTCGTGCTCGACACGGATGGTGGTGTTCTTCAAAATGGTGGCCAATATTCTGTGTTGCCGGTCATGAGAGGAAGTGGTGGTGGACTAGTAGTACGTGCAACTGGAAATGAAAGATGCCCTCTCACTGTTGCGCAAACTCGCAATGAGCTCGATAAGGGGATTGGAACAATTATTTCATCCCCATTACGAGTCGCTGTTATCGCCGAAGGCCATCCTTTGAGCATTTCGTTCGGTTTTTTTCCAGTTATGCCGTCTTGTATCCCTCTTACTGGTGATTGGGGTATTGTGGATGGTCTACCTGAAGGACCCGCTGTTAAACTTGCTGAGTACAAAAACATAGTAGATGGTTGGTTTAAAATTGAGAAAGCTCACCCTCTCGGTTATAAGCTTTTGTTCTGTCCACTGCTTGAGGGTAGCACATGTGGGGATATTGGAATTCAAACTGATGATGATGGAATCAGGCGTTTGGTGGTGACTAAGAACAATCCATTACTGGTTCAGTTTCAGAAAATTGGATGGATACTGACGAAGAACAATCTTTTGCTTCCTGGCAGTGAGTGA

>Glyma01g11640.1   sequence type=predicted peptide   gene model=Glyma01g11640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKSSTLFALFLLSAIFTSYLPSATADVVLDTDGGVLQNGGQYSVLPVMRGSGGGLVVRATGNERCPLTVAQTRNELDKGIGTIISSPLRVAVIAEGHPLSISFGFFPVMPSCIPLTGDWGIVDGLPEGPAVKLAEYKNIVDGWFKIEKAHPLGYKLLFCPLLEGSTCGDIGIQTDDDGIRRLVVTKNNPLLVQFQKIGWILTKNNLLLPGSE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo