Glyma01g10390 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g10390): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g10390): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g10390

Feature Type:	gene_model
Chromosome:	Gm01
Start:	13444507
stop:	13445181
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g10390

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G45050	AT	Annotation by Michelle Graham. TAIR10: GATA transcription factor 2 \| chr2:18582958-18583845 FORWARD LENGTH=264	SoyBase	E_val: 1.00E-28	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009416	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to light stimulus	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
PTHR10071	Panther	TRANSCRIPTION FACTOR GATA (GATA BINDING FACTOR)	JGI		ISS
PTHR10071:SF113	Panther	ZINC FINGER (GATA TYPE) FAMILY PROTEIN	JGI		ISS
PF00320	PFAM	GATA zinc finger	JGI		ISS
UniRef100_E4MW74	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: mRNA, clone: RTFL01-03-P20 n=1 Tax=Eutrema halophilum RepID=E4MW74_THEHA	SoyBase	E_val: 4.00E-26	ISS
UniRef100_I1J6A3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J6A3_SOYBN	SoyBase	E_val: 3.00E-112	ISS

Expression Patterns of Glyma01g10390

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g10390 not represented in the dataset	Glyma01g10390 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g10390 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.01g073100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma01g10390

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g10390

Limit To All Plant Sequences

>Glyma01g10390.1   sequence type=CDS   gene model=Glyma01g10390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTATCGCAAATTATGGGTTCCTAGAACACCCACTTTGTGTCCCTCAGGACTCATTAGAATGTTTGGGAATGATGAATTGGGAAGGCATGGATTCAATTGATTCCATGTTTTCTACCCCTTGGGAGAGTGAAAAGGAAAGATTGGAACAACCTGAAAAGGATAAAACGGAGAGGAAATCATTCACTGATAGTGGGAGGGATGCTAAGATCTGGGAGAAAAGATGTGGTCACAAGGATGCTAGGATCTGGGAGAGAAGATGTAGTCATTGTGACGCCATAAAAACTCCTCAATGGAGAACCGGTCCTTTTGGGCGAAATACTCTGTGCAATGCTTGTGGTATACGATTCAAGGCAGGGAAGTTATATCCAGAGTATAGACCTGCAGATAGTCCAACGTTTGATGTAAGCAAGCATTCAAATGTTCATAAAGAGATAATGAAAATGAGAAACCACCTTAGTTAA

Predicted protein sequences of Glyma01g10390

Limit To All Plant Sequences

>Glyma01g10390.1   sequence type=predicted peptide   gene model=Glyma01g10390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVIANYGFLEHPLCVPQDSLECLGMMNWEGMDSIDSMFSTPWESEKERLEQPEKDKTERKSFTDSGRDAKIWEKRCGHKDARIWERRCSHCDAIKTPQWRTGPFGRNTLCNACGIRFKAGKLYPEYRPADSPTFDVSKHSNVHKEIMKMRNHLS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain