|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G16080 | AT | Annotation by Michelle Graham. TAIR10: unknown protein; LOCATED IN: apoplast, chloroplast stroma, chloroplast, chloroplast envelope; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 14 growth stages; Has 81 Blast hits to 81 proteins in 28 species: Archae - 0; Bacteria - 2; Metazoa - 0; Fungi - 0; Plants - 62; Viruses - 0; Other Eukaryotes - 17 (source: NCBI BLink). | chr1:5514394-5515761 FORWARD LENGTH=313 | SoyBase | E_val: 2.00E-48 | ISS |
| GO:0006098 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt | SoyBase | N/A | ISS |
| GO:0009965 | GO-bp | Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis | SoyBase | N/A | ISS |
| GO:0010027 | GO-bp | Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization | SoyBase | N/A | ISS |
| GO:0016117 | GO-bp | Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process | SoyBase | N/A | ISS |
| GO:0030154 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell differentiation | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
| GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
| GO:0048046 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: apoplast | SoyBase | N/A | ISS |
| UniRef100_I1J6A2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J6A2_SOYBN | SoyBase | E_val: 5.00E-77 | ISS |
| UniRef100_Q014K3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: WGS project CAID00000000 data, contig chromosome 07 n=1 Tax=Ostreococcus tauri RepID=Q014K3_OSTTA | SoyBase | E_val: 1.00E-24 | ISS |
|
Glyma01g10350 not represented in the dataset |
Glyma01g10350 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.01g072800 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g10350.1 sequence type=CDS gene model=Glyma01g10350 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTGGAGAAGCTTATATGGATTTGTTCCGTTATGCTTGTTGGAGCACGACATGGAGGGGTTTCTGTAGGTGTTGTGGAAAAGGAATTTCGCACTGAATTGTCTAGCCTTATAACAGAACTAGCATCAACAGCAACAAATGAAAAGAGGTTAACATTTGAAGAAGCCATGGAAGAGTGCTTATGTGCATATTCTCCAACTGTAGCCCTCTTTCCCACAACAGTTAAGGAGTTCAAATGGAGAAATGGTTGGTTTTGTTCTCTCTCTAAGAAGGCTACTGCCCAAGGCAAGCCATACTCATGTGCTTTGCATTCCCAATGGCTAAAACAGTTGAGAATTGTATGA
>Glyma01g10350.1 sequence type=predicted peptide gene model=Glyma01g10350 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLEKLIWICSVMLVGARHGGVSVGVVEKEFRTELSSLITELASTATNEKRLTFEEAMEECLCAYSPTVALFPTTVKEFKWRNGWFCSLSKKATAQGKPYSCALHSQWLKQLRIV*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||