SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g10302): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g10302): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g10302

Feature Type:gene_model
Chromosome:Gm01
Start:13355410
stop:13356481
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g10302
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G53000AT Annotation by Michelle Graham. TAIR10: 2A phosphatase associated protein of 46 kD | chr5:21485654-21487869 REVERSE LENGTH=405 SoyBaseE_val: 4.00E-27ISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009966GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of signal transduction SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
PTHR10933Panther IMMUNOGLOBULIN-BINDING PROTEIN 1-RELATED JGI ISS
PF04177PFAM TAP42-like family JGI ISS
UniRef100_G7J7F3UniRef Annotation by Michelle Graham. Most informative UniRef hit: PP2A regulatory subunit TAP46 n=1 Tax=Medicago truncatula RepID=G7J7F3_MEDTR SoyBaseE_val: 7.00E-31ISS
UniRef100_UPI0002337709UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337709 related cluster n=1 Tax=unknown RepID=UPI0002337709 SoyBaseE_val: 1.00E-43ISS

Expression Patterns of Glyma01g10302
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g10302 not represented in the dataset
Glyma01g10302 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g10302 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g072500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g10302
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g10302
>Glyma01g10302.1   sequence type=CDS   gene model=Glyma01g10302   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACGACTTGCCATTGTCGGCGCTCTTTGAGCAAGCCCGCAAGATCCACACCACAACCACCGATTCTAGCACCGACCAGGAGGTTGTAAAGAAGGGGTGCGAGGCTCTGCATAGATGCGAGGACATGGTCAATAATCTAGGTTTGTTCTCTCCCAACGAGACCAAAGAAGATATCAACACCACCAATCTCAAGTACATCCTGGTTCCAATGGAGCTGTTCCCGAAAGAGGAGGTTTGTGTCTAA
Predicted protein sequences of Glyma01g10302
>Glyma01g10302.1   sequence type=predicted peptide   gene model=Glyma01g10302   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDDLPLSALFEQARKIHTTTTDSSTDQEVVKKGCEALHRCEDMVNNLGLFSPNETKEDINTTNLKYILVPMELFPKEEVCV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo