SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g10141): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g10141): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g10141

Feature Type:gene_model
Chromosome:Gm01
Start:13045088
stop:13045509
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G26751AT Annotation by Michelle Graham. TAIR10: shaggy-related kinase 11 | chr5:9399582-9401839 REVERSE LENGTH=405 SoyBaseE_val: 1.00E-29ISS
GO:0009933GO-bp Annotation by Michelle Graham. GO Biological Process: meristem structural organization SoyBaseN/AISS
GO:0016310GO-bp Annotation by Michelle Graham. GO Biological Process: phosphorylation SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
PTHR24057Panther GLYCOGEN SYNTHASE KINASE-3 ALPHA JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_I1L7L8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L7L8_SOYBN SoyBaseE_val: 2.00E-34ISS
UniRef100_Q9ZRU3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein kinase (Fragment) n=1 Tax=Cicer arietinum RepID=Q9ZRU3_CICAR SoyBaseE_val: 1.00E-31ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g10141 not represented in the dataset

Glyma01g10141 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g071900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g10141.1   sequence type=CDS   gene model=Glyma01g10141   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAAGGACGAGCTTTATCTTAATTTGGTACTTGAGTTTGTTCCTGAGATTGACCACCAAGTTATCAGACATTACAACAAAATGAGTCAAAGAATGCCTTTGATATATATGAAACTCTATTTTTACCAGATATGTAGAGCACTAGCTTATATTCACAACTGTATTGGAGTGTCTCACAGGGACATAAAAGATGTTGTTATGCTTGCTTTCTTCTTGAAAATTAACAAACATCAGCATAGAAAAGGGGAAAAGAAAAAAGGAAATGTGAATTATACCATTGTCATGAATAAACTATCCTAA

>Glyma01g10141.1   sequence type=predicted peptide   gene model=Glyma01g10141   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKDELYLNLVLEFVPEIDHQVIRHYNKMSQRMPLIYMKLYFYQICRALAYIHNCIGVSHRDIKDVVMLAFFLKINKHQHRKGEKKKGNVNYTIVMNKLS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo