SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g09631): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g09631): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g09631

Feature Type:gene_model
Chromosome:Gm01
Start:11934523
stop:11935027
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g09631
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G03280AT Annotation by Michelle Graham. TAIR10: Transcription factor TFIIE, alpha subunit | chr1:803635-806758 FORWARD LENGTH=479 SoyBaseE_val: 2.00E-25ISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0000956GO-bp Annotation by Michelle Graham. GO Biological Process: nuclear-transcribed mRNA catabolic process SoyBaseN/AISS
GO:0006366GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from RNA polymerase II promoter SoyBaseN/AISS
GO:0006367GO-bp Annotation by Michelle Graham. GO Biological Process: transcription initiation from RNA polymerase II promoter SoyBaseN/AISS
GO:0006487GO-bp Annotation by Michelle Graham. GO Biological Process: protein N-linked glycosylation SoyBaseN/AISS
GO:0007346GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of mitotic cell cycle SoyBaseN/AISS
GO:0010048GO-bp Annotation by Michelle Graham. GO Biological Process: vernalization response SoyBaseN/AISS
GO:0048573GO-bp Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005673GO-cc Annotation by Michelle Graham. GO Cellular Compartment: transcription factor TFIIE complex SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
UniRef100_G7LDX0UniRef Annotation by Michelle Graham. Most informative UniRef hit: General transcription factor IIE subunit n=1 Tax=Medicago truncatula RepID=G7LDX0_MEDTR SoyBaseE_val: 4.00E-54ISS
UniRef100_I1MUG7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MUG7_SOYBN SoyBaseE_val: 3.00E-66ISS

Expression Patterns of Glyma01g09631
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g09631 not represented in the dataset
Glyma01g09631 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g09631 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma01g09631
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g09631
>Glyma01g09631.1   sequence type=CDS   gene model=Glyma01g09631   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCTGAAACTGACAGTACATCTTTAAAGGTTTTGCCTCCATGGATGATTACATCAGGTGTGAATCTTACAAAGGAACAACATGGAGAGGTGAAGCAAGAAACAAAGATGGATGGGACTTCAACTTCCACAACAGCACAGAACACAGATGACAAGAAGTCAAAAATTGGACATGACAACAATCAAAATATTCAGGATAAGTATATTAAGGCTTATTATGCTGCTTTACTTAAACAACAACACAAATTGGAAGAAGTTGCAAAAAAACAATTGTCAAACACATTTGCTGCTGCTAATCCTTCTAGCAGTACTTCCAATCGTCAGGTTGGCATGAAATCAAAATGTGAGGAAGACGATGATGATACTGAATGGGAGGAGGCTCCAATTGCA
Predicted protein sequences of Glyma01g09631
>Glyma01g09631.1   sequence type=predicted peptide   gene model=Glyma01g09631   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SETDSTSLKVLPPWMITSGVNLTKEQHGEVKQETKMDGTSTSTTAQNTDDKKSKIGHDNNQNIQDKYIKAYYAALLKQQHKLEEVAKKQLSNTFAAANPSSSTSNRQVGMKSKCEEDDDDTEWEEAPIA






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo