Glyma01g09540 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g09540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g09540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g09540

Feature Type:	gene_model
Chromosome:	Gm01
Start:	11708035
stop:	11708550
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma01g09540

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G28840	AT	Annotation by Michelle Graham. TAIR10: GDP-D-mannose 3',5'-epimerase \| chr5:10862472-10864024 REVERSE LENGTH=377	SoyBase	E_val: 1.00E-64	ISS
GO:0009225	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide-sugar metabolic process	SoyBase	N/A	ISS
GO:0019853	GO-bp	Annotation by Michelle Graham. GO Biological Process: L-ascorbic acid biosynthetic process	SoyBase	N/A	ISS
GO:0044237	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular metabolic process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0047918	GO-mf	Annotation by Michelle Graham. GO Molecular Function: GDP-mannose 3,5-epimerase activity	SoyBase	N/A	ISS
GO:0050662	GO-mf	Annotation by Michelle Graham. GO Molecular Function: coenzyme binding	SoyBase	N/A	ISS
GO:0051287	GO-mf	Annotation by Michelle Graham. GO Molecular Function: NAD binding	SoyBase	N/A	ISS
PTHR10366	Panther	NAD DEPENDENT EPIMERASE/DEHYDRATASE	JGI		ISS
PTHR10366:SF35	Panther	gb def: udp-glucose 4-epimerase [bacillus halodurans]	JGI		ISS
PF01370	PFAM	NAD dependent epimerase/dehydratase family	JGI		ISS
UniRef100_G7L1X0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: GDP-mannose 3 5-epimerase n=1 Tax=Medicago truncatula RepID=G7L1X0_MEDTR	SoyBase	E_val: 3.00E-63	ISS
UniRef100_I1NC94	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1NC94_SOYBN	SoyBase	E_val: 2.00E-65	ISS

Expression Patterns of Glyma01g09540

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g09540 not represented in the dataset	Glyma01g09540 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g09540 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma01g09540

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma01g09540

Limit To All Plant Sequences

>Glyma01g09540.1   sequence type=CDS   gene model=Glyma01g09540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTGGAGACAAATGTGAGTTTGAAGGAGTCTGATGCCTGGCCTGCTGAGCCACAAGATGCATATGGGCTGGAGAAGCTTGCAACAGAAGAGTTATGCAAGCATTATAACAAGGATTTTGGAATTGAGTGCCGCATTGGGAGATTCCATAACATATATGGTCCTTATGGGACATGGAAGGGTGGGAGGGAGAAGGCTCCTGCTGCTTTTTGTCGCAAGTCACTTACTTCCAAAGACCGATTTGAGATGTGGGGAGATGGATTGCAAACAAGATCCTTCACCTTCATTGATGAGTGT

Predicted protein sequences of Glyma01g09540

Limit To All Plant Sequences

>Glyma01g09540.1   sequence type=predicted peptide   gene model=Glyma01g09540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LETNVSLKESDAWPAEPQDAYGLEKLATEELCKHYNKDFGIECRIGRFHNIYGPYGTWKGGREKAPAAFCRKSLTSKDRFEMWGDGLQTRSFTFIDEC

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain