|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G52650 | AT | Annotation by Michelle Graham. TAIR10: RNA binding Plectin/S10 domain-containing protein | chr5:21355781-21357003 REVERSE LENGTH=179 | SoyBase | E_val: 4.00E-16 | ISS |
| GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
| GO:0009664 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization | SoyBase | N/A | ISS |
| GO:0042545 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall modification | SoyBase | N/A | ISS |
| GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0022626 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome | SoyBase | N/A | ISS |
| GO:0022627 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit | SoyBase | N/A | ISS |
| GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
| PTHR12146 | Panther | 40S RIBOSOMAL PROTEIN S10 | JGI | ISS | |
| PF03501 | PFAM | Plectin/S10 domain | JGI | ISS | |
| UniRef100_C6T1S1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T1S1_SOYBN | SoyBase | E_val: 2.00E-15 | ISS |
| UniRef100_F4YFA1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein s10 n=1 Tax=Camellia sinensis RepID=F4YFA1_CAMSI | SoyBase | E_val: 1.00E-14 | ISS |
|
Glyma01g09500 not represented in the dataset |
Glyma01g09500 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.01g069200 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g09500.1 sequence type=CDS gene model=Glyma01g09500 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATCATTCTCGAGAAGAACCGTAAAGAGATCTGCAAATACATCTTCCAAGAGGGAGTTTGCTTTGCGAAGAAGGACTTCAATGTGGCAAAGCACCCAGAGATTGAT
>Glyma01g09500.1 sequence type=predicted peptide gene model=Glyma01g09500 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high IILEKNRKEICKYIFQEGVCFAKKDFNVAKHPEID
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||