SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g09381): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g09381): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g09381

Feature Type:gene_model
Chromosome:Gm01
Start:11366556
stop:11369128
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G26600AT Annotation by Michelle Graham. TAIR10: S-adenosyl-L-methionine-dependent methyltransferases superfamily protein | chr4:13419629-13423418 FORWARD LENGTH=671 SoyBaseE_val: 6.00E-103ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006606GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into nucleus SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005730GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleolus SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0008168GO-mf Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity SoyBaseN/AISS
GO:0008757GO-mf Annotation by Michelle Graham. GO Molecular Function: S-adenosylmethionine-dependent methyltransferase activity SoyBaseN/AISS
PTHR22807Panther NOP2(YEAST)-RELATED NOL1/NOP2/FMU(SUN) DOMAIN-CONTAINING JGI ISS
PTHR22807:SF11Panther NUCLEOLAR PROTEIN NOL1/NOP2(YEAST) JGI ISS
PF01189PFAM NOL1/NOP2/sun family JGI ISS
UniRef100_B9S9W8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Proliferating-cell nucleolar antigen p120, putative n=1 Tax=Ricinus communis RepID=B9S9W8_RICCO SoyBaseE_val: 1.00E-101ISS
UniRef100_UPI000233ECD5UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233ECD5 related cluster n=1 Tax=unknown RepID=UPI000233ECD5 SoyBaseE_val: 2.00E-121ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g09381 not represented in the dataset

Glyma01g09381 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g068500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g09381.1   sequence type=CDS   gene model=Glyma01g09381   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGCGGCATCGGAGTGGTGAACAAGTGAAGCTCGCAGTCGTACATGGCTTTCTTGGCGGGAATGGAGAGCACGGACTAGGCATCGTTGATGAGGGAGAAGGCGTGGCTGGCGAAGGTGTACATGTTGTGGTGAGGGTCGAGGAGGAGCACGAGGCGGCGATACTGGGCACCAATGTGGTCCATGTTGGTGGTGTAGCGAAGGATTTGAAGGATCCTCTACCAATCACGGTGGTGGTCATTGATCCGCGACTCACCGACGATGAGCGTGTCGATCACCCAAGGGATGACGATTCGGATGATGGTAATACTGAAAAGAAGTCGAGAGCTATTGATGAAGAGAAAGAGAAAGAGGAAGAGGACACGGATGCCGAAATGCAGCTCAACATCAACCAAGAGTCTAATGAGTTCAGATTGCCTACCAAAGAGGAGCTTGAGGAGGAGGCTCTCCGCCCACCTGATCTTTCCAATCTCCAGAGGAGAACCAAAGAGAATATAAGATGTTGTAATTGTTTTAAATGTCTTAAGAAAGATTTATGTACCTACTATGGCTACAATGAGTTCCTAATTGGTGCTCTAGTGGAGGTTGTTGTTGAACTTATGGAACTGATTGAAGCCTTTGAAAAGCCACGTCCTATATGTCTGAGGACTAATACATTGAAGACACGCAGATGGGATTTGGCGGATGTTTTGATAAATAGGGGAGTAAATTTGGATCCTCTAAGCAAATGGTCAACGGTTGGACTTGTGGTGTATGATTCTCAAGTGCCTATTGGTGCCACTCCTGAGTATATGGCTGGTTTCTACACGCTACAAAGTGCAAGCTCTTTTTTGCCCTTTATGGCTTTGGCTCCTCAAGAGAAGGAACGAGTTGTTGATATGGCAGCTGCACCTGGTGGTAAAACAACTTACATTGCTGCTCTAATGATGAATACTGATTAA

>Glyma01g09381.1   sequence type=predicted peptide   gene model=Glyma01g09381   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLRHRSGEQVKLAVVHGFLGGNGEHGLGIVDEGEGVAGEGVHVVVRVEEEHEAAILGTNVVHVGGVAKDLKDPLPITVVVIDPRLTDDERVDHPRDDDSDDGNTEKKSRAIDEEKEKEEEDTDAEMQLNINQESNEFRLPTKEELEEEALRPPDLSNLQRRTKENIRCCNCFKCLKKDLCTYYGYNEFLIGALVEVVVELMELIEAFEKPRPICLRTNTLKTRRWDLADVLINRGVNLDPLSKWSTVGLVVYDSQVPIGATPEYMAGFYTLQSASSFLPFMALAPQEKERVVDMAAAPGGKTTYIAALMMNTD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo