|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G44150 | AT | Annotation by Michelle Graham. TAIR10: histone-lysine N-methyltransferase ASHH3 | chr2:18258863-18261003 FORWARD LENGTH=363 | SoyBase | E_val: 4.00E-31 | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS |
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
| GO:0016279 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein-lysine N-methyltransferase activity | SoyBase | N/A | ISS |
| GO:0018024 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: histone-lysine N-methyltransferase activity | SoyBase | N/A | ISS |
| PTHR22884 | Panther | SET DOMAIN PROTEINS | JGI | ISS | |
| PTHR22884:SF35 | Panther | SET DOMAIN PROTEIN | JGI | ISS | |
| PF00856 | PFAM | SET domain | JGI | ISS | |
| UniRef100_G7KMG0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Histone-lysine N-methyltransferase ASHH3 n=1 Tax=Medicago truncatula RepID=G7KMG0_MEDTR | SoyBase | E_val: 2.00E-31 | ISS |
| UniRef100_UPI00023388E3 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI00023388E3 related cluster n=1 Tax=unknown RepID=UPI00023388E3 | SoyBase | E_val: 2.00E-34 | ISS |
|
Glyma01g08400 not represented in the dataset |
Glyma01g08400 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.01g064800 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g08400.1 sequence type=CDS gene model=Glyma01g08400 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAACAACGTGGGGAAAGAAACTTCTACTTATGTGAAATCAACCGAGATATGGTGATAGATGCCACATATAAGGGAAACAAATCAAGATACACCAATCATAGTTGTTGTCCCAATACTGAGATGCAGAAATGGATAATTGATGGTGAAACAAGAATTGGCATATTTGCAACTAGTGACATACAAAAGGATATTTATGCCTTTGGAAAGTTTTGGAGATGTTGGTCTCTCAGGAATTATGCTAGCATGACTGGCTGGTTATTCTATGTTTCTAACTACATAGTAGGTTTGCTCCATTTGGTGCATATCAAGATTGCCATTGAGGTGTTGCTGAGTGCAAGCGTAAGTTGGGTGTCCGACCTACCAAGCCTAAACTTTCTTTAG
>Glyma01g08400.1 sequence type=predicted peptide gene model=Glyma01g08400 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKQRGERNFYLCEINRDMVIDATYKGNKSRYTNHSCCPNTEMQKWIIDGETRIGIFATSDIQKDIYAFGKFWRCWSLRNYASMTGWLFYVSNYIVGLLHLVHIKIAIEVLLSASVSWVSDLPSLNFL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||