SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g08150

Feature Type:gene_model
Chromosome:Gm01
Start:9446810
stop:9451393
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g08150
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G69120AT Annotation by Michelle Graham. TAIR10: K-box region and MADS-box transcription factor family protein | chr1:25982576-25986102 REVERSE LENGTH=256 SoyBaseE_val: 4.00E-109ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009556GO-bp Annotation by Michelle Graham. GO Biological Process: microsporogenesis SoyBaseN/AISS
GO:0009827GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0009886GO-bp Annotation by Michelle Graham. GO Biological Process: post-embryonic morphogenesis SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009933GO-bp Annotation by Michelle Graham. GO Biological Process: meristem structural organization SoyBaseN/AISS
GO:0010076GO-bp Annotation by Michelle Graham. GO Biological Process: maintenance of floral meristem identity SoyBaseN/AISS
GO:0010093GO-bp Annotation by Michelle Graham. GO Biological Process: specification of floral organ identity SoyBaseN/AISS
GO:0010582GO-bp Annotation by Michelle Graham. GO Biological Process: floral meristem determinacy SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0048440GO-bp Annotation by Michelle Graham. GO Biological Process: carpel development SoyBaseN/AISS
GO:0048441GO-bp Annotation by Michelle Graham. GO Biological Process: petal development SoyBaseN/AISS
GO:0048443GO-bp Annotation by Michelle Graham. GO Biological Process: stamen development SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0048507GO-bp Annotation by Michelle Graham. GO Biological Process: meristem development SoyBaseN/AISS
GO:0052543GO-bp Annotation by Michelle Graham. GO Biological Process: callose deposition in cell wall SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0046982GO-mf Annotation by Michelle Graham. GO Molecular Function: protein heterodimerization activity SoyBaseN/AISS
KOG0014 KOG MADS box transcription factor JGI ISS
PTHR11945Panther MADS BOX PROTEIN JGI ISS
PTHR11945:SF19Panther MADS BOX PROTEIN JGI ISS
PF00319PFAM SRF-type transcription factor (DNA-binding and dimerisation domain) JGI ISS
PF01486PFAM K-box region JGI ISS
UniRef100_E1CKY3UniRef Annotation by Michelle Graham. Most informative UniRef hit: APETALA1 n=1 Tax=Vigna unguiculata RepID=E1CKY3_VIGUN SoyBaseE_val: 5.00E-144ISS
UniRef100_I1J646UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J646_SOYBN SoyBaseE_val: 2.00E-180ISS

Expression Patterns of Glyma01g08150
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma01g08150
ParalogEvidenceComments
Glyma02g13420 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma01g08150 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g064200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g08150
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g08150
>Glyma01g08150.1   sequence type=CDS   gene model=Glyma01g08150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAGGGGTAAGGTACAGCTGAAGAGGATAGAGAACAAGATCAATCGCCAGGTAACTTTCTCCAAAAGGAGAAGTGGGTTGCTCAAGAAAGCTCATGAGATCTCTGTACTCTGTGATGCTGAGGTAGCTTTGATTGTCTTCTCTCACAAAGGAAAGCTCTTTGAGTATGCTACTGATTCATGCATGGAGAAGATACTGGAACGCCACGAAAGGTATGCCTATGCAGAGAGGCAGCTAGTAGCAAATGATTCTGAAACACAGGGAAACTGGACCATTGAATACACTAGACTGAAGGCAAAGATTGACCTTTTACAGAGAAACCACAGGCACTATATGGGAGAAGATTTGGCTTCAATGAGCCTCAAAGAGCTTCAGAGTTTGGAGCAGCAGTTGGATACTGCTATCAAAAACATCCGCACAAGGAGGAATGATCTCATGTACGCTTCCATTTCTGAGCTTCAAAAAAAGGAGAAAATGATACAAGAGCAGAATAACATCCTTGCAAAGAAGATCAAGGAGAAAGAGCAGGCAGTAGCACAGCAAGCTGCACAATGGGAGCAGCCAAACTACAGGGTTGATACATCTTTCATGCCACAGCAGCAACCCCTTCGCACCAGTTTGAACATAGGCGGCAATAATTACAATCAGGAAGCTGCACCAGAACTAGGAAGGAATGGTCTTGACCTGACCCTGGAACCACTGTATTCTTGCCACCTTGGATGCTTCTGA
Predicted protein sequences of Glyma01g08150
>Glyma01g08150.1   sequence type=predicted peptide   gene model=Glyma01g08150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRGKVQLKRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSHKGKLFEYATDSCMEKILERHERYAYAERQLVANDSETQGNWTIEYTRLKAKIDLLQRNHRHYMGEDLASMSLKELQSLEQQLDTAIKNIRTRRNDLMYASISELQKKEKMIQEQNNILAKKIKEKEQAVAQQAAQWEQPNYRVDTSFMPQQQPLRTSLNIGGNNYNQEAAPELGRNGLDLTLEPLYSCHLGCF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo