|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G37860 | AT | Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF3411) | chr2:15856952-15858351 FORWARD LENGTH=347 | SoyBase | E_val: 2.00E-16 | ISS |
| GO:0048366 | GO-bp | Annotation by Michelle Graham. GO Biological Process: leaf development | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009536 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastid | SoyBase | N/A | ISS |
| GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PF11891 | PFAM | Domain of unknown function (DUF3411) | JGI | ISS | |
| UniRef100_C0Z2Z2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: AT2G37860 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2Z2_ARATH | SoyBase | E_val: 3.00E-13 | ISS |
| UniRef100_I1KK44 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KK44_SOYBN | SoyBase | E_val: 3.00E-15 | ISS |
|
Glyma01g08015 not represented in the dataset |
Glyma01g08015 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.01g063400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma01g08015.1 sequence type=CDS gene model=Glyma01g08015 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAATTCAAAAAGAGAGGCAAAGACTTTTGGGTCGAATTTGAGTTGTATCTTGCAGATCTTCTTGTTGGGCTGGTTGTTAATGTTGCTTTGGTTGGTATGTTGGCACCCTATGCTCGTTCCCTGATCATAAAGACATCAGAAGAAGACATACCTGTGCCACCACTTGTGAAGAGTGCTTCTCTTTGGGGTATGATCTTGTTCTGTTTAAAAATATTACATGATTTCTAG
>Glyma01g08015.1 sequence type=predicted peptide gene model=Glyma01g08015 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKFKKRGKDFWVEFELYLADLLVGLVVNVALVGMLAPYARSLIIKTSEEDIPVPPLVKSASLWGMILFCLKILHDF*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||