SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g08015

Feature Type:gene_model
Chromosome:Gm01
Start:8998366
stop:8999926
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g08015
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G37860AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF3411) | chr2:15856952-15858351 FORWARD LENGTH=347 SoyBaseE_val: 2.00E-16ISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF11891PFAM Domain of unknown function (DUF3411) JGI ISS
UniRef100_C0Z2Z2UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT2G37860 protein n=1 Tax=Arabidopsis thaliana RepID=C0Z2Z2_ARATH SoyBaseE_val: 3.00E-13ISS
UniRef100_I1KK44UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KK44_SOYBN SoyBaseE_val: 3.00E-15ISS

Expression Patterns of Glyma01g08015
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g08015 not represented in the dataset
Glyma01g08015 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g08015 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g063400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g08015
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g08015
>Glyma01g08015.1   sequence type=CDS   gene model=Glyma01g08015   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAATTCAAAAAGAGAGGCAAAGACTTTTGGGTCGAATTTGAGTTGTATCTTGCAGATCTTCTTGTTGGGCTGGTTGTTAATGTTGCTTTGGTTGGTATGTTGGCACCCTATGCTCGTTCCCTGATCATAAAGACATCAGAAGAAGACATACCTGTGCCACCACTTGTGAAGAGTGCTTCTCTTTGGGGTATGATCTTGTTCTGTTTAAAAATATTACATGATTTCTAG
Predicted protein sequences of Glyma01g08015
>Glyma01g08015.1   sequence type=predicted peptide   gene model=Glyma01g08015   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKFKKRGKDFWVEFELYLADLLVGLVVNVALVGMLAPYARSLIIKTSEEDIPVPPLVKSASLWGMILFCLKILHDF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo