SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g08001

Feature Type:gene_model
Chromosome:Gm01
Start:8978274
stop:8979785
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g08001
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G17940AT Annotation by Michelle Graham. TAIR10: Endosomal targeting BRO1-like domain-containing protein | chr1:6169621-6172035 REVERSE LENGTH=405 SoyBaseE_val: 2.00E-59ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR23030Panther PCD6 INTERACTING PROTEIN-RELATED JGI ISS
PTHR23030:SF17Panther JGI ISS
PF03097PFAM BRO1-like domain JGI ISS
UniRef100_D0ABE6UniRef Annotation by Michelle Graham. Most informative UniRef hit: OO_Ba0013J05-OO_Ba0033A15.3 protein n=1 Tax=Oryza officinalis RepID=D0ABE6_9ORYZ SoyBaseE_val: 4.00E-48ISS
UniRef100_I1MQF2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MQF2_SOYBN SoyBaseE_val: 4.00E-66ISS

Expression Patterns of Glyma01g08001
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g08001 not represented in the dataset
Glyma01g08001 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g08001 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g063300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g08001
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g08001
>Glyma01g08001.1   sequence type=CDS   gene model=Glyma01g08001   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAATTGATAGTACCAAAGCCACTCTTGTTGTGAAGTGTAGGCTTGCATGTGAGATGGTGAAATGTTGGCAACAGGCTCAAGATAACATTATGAATCTTCCATTAGATAATGGTTGGGGTGAAAAGCATTGTCTTTTTGTGAAATGGAAATATGTTGAAGCAAAGGCTGCAACATATTATTATCATGGTTTGATTCTTGATGAGGGAAATACAGAAAAATCTCATGGGATGGTTGTAGTTGCTTTGCAAGCAGCAAATGAGTATTTCAAAGAAAGTAAGAAGTTGTGTGAGGCATTCAACGTAGCATCTCCATTGTCAAGGTTATCATTTTCCTTCCCTCTTACACACTTTTATGTTGTTATATGCTCTCAGAAAACAAGGTTTTAG
Predicted protein sequences of Glyma01g08001
>Glyma01g08001.1   sequence type=predicted peptide   gene model=Glyma01g08001   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAIDSTKATLVVKCRLACEMVKCWQQAQDNIMNLPLDNGWGEKHCLFVKWKYVEAKAATYYYHGLILDEGNTEKSHGMVVVALQAANEYFKESKKLCEAFNVASPLSRLSFSFPLTHFYVVICSQKTRF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo