SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g07985

Feature Type:gene_model
Chromosome:Gm01
Start:8949065
stop:8950284
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g07985
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G55860AT Annotation by Michelle Graham. TAIR10: Plant protein of unknown function (DUF827) | chr5:22610146-22612166 FORWARD LENGTH=649 SoyBaseE_val: 5.00E-30ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_B9S9W3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Paramyosin, putative n=1 Tax=Ricinus communis RepID=B9S9W3_RICCO SoyBaseE_val: 6.00E-44ISS
UniRef100_I1N092UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N092_SOYBN SoyBaseE_val: 1.00E-60ISS

Expression Patterns of Glyma01g07985
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g07985 not represented in the dataset
Glyma01g07985 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g07985 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma01g07985
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g07985
>Glyma01g07985.1   sequence type=CDS   gene model=Glyma01g07985   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCGCGGTAACACAAGCGAAAAGGGCAGTGGAGAGTGAGCTTCGAAGATGGCGCGAGAGGGTGCAAAAGAGGGCCGCAGAAGCTGCATCTCGAATTCTGGCTGAAACACAGGTGTCAACAAAATCATCTCCTCAGCACTATAGGATTCAAAAGCAGAATCCTCCTCGTACAATGGTGGAGGTGAAAAAGTTTGAAAAGGAGAAGGTTTCAGTTTCAAAGAAAACCCTCTTGCCAAATATTAGTGGCATCTTCCAAAGGAAAAAGAACCAGGTTAAGGGTGGTTCTCCTTCTTATCTGCCTGGTGAGAACCCTGTATGA
Predicted protein sequences of Glyma01g07985
>Glyma01g07985.1   sequence type=predicted peptide   gene model=Glyma01g07985   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLAVTQAKRAVESELRRWRERVQKRAAEAASRILAETQVSTKSSPQHYRIQKQNPPRTMVEVKKFEKEKVSVSKKTLLPNISGIFQRKKNQVKGGSPSYLPGENPV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo