SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma01g07930): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma01g07930): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma01g07930

Feature Type:gene_model
Chromosome:Gm01
Start:8874760
stop:8878203
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G02230AT Annotation by Michelle Graham. TAIR10: reversibly glycosylated polypeptide 1 | chr3:415463-417304 FORWARD LENGTH=357 SoyBaseE_val: 0ISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009832GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis SoyBaseN/AISS
GO:0030244GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process SoyBaseN/AISS
GO:0033356GO-bp Annotation by Michelle Graham. GO Biological Process: UDP-L-arabinose metabolic process SoyBaseN/AISS
GO:0071555GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall organization SoyBaseN/AISS
GO:0071669GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization or biogenesis SoyBaseN/AISS
GO:0000138GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi trans cisterna SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005795GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi stack SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0030054GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell junction SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008466GO-mf Annotation by Michelle Graham. GO Molecular Function: glycogenin glucosyltransferase activity SoyBaseN/AISS
GO:0016758GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring hexosyl groups SoyBaseN/AISS
GO:0016760GO-mf Annotation by Michelle Graham. GO Molecular Function: cellulose synthase (UDP-forming) activity SoyBaseN/AISS
GO:0016866GO-mf Annotation by Michelle Graham. GO Molecular Function: intramolecular transferase activity SoyBaseN/AISS
GO:0052691GO-mf Annotation by Michelle Graham. GO Molecular Function: UDP-arabinopyranose mutase activity SoyBaseN/AISS
PF03214PFAM Reversibly glycosylated polypeptide JGI ISS
UniRef100_I1J637UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J637_SOYBN SoyBaseE_val: 0ISS
UniRef100_O04300UniRef Annotation by Michelle Graham. Most informative UniRef hit: Alpha-1,4-glucan-protein synthase [UDP-forming] n=1 Tax=Pisum sativum RepID=UPTG_PEA SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g07930 not represented in the dataset

Glyma01g07930 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma02g13330 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g063000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma01g07930.1   sequence type=CDS   gene model=Glyma01g07930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGCAACCTTCCTCCTCCTCGAAGCCTGTTGTCCCTCTCCTGAAGGACGAGCTGGACATCGTGATCCCGACAATCCGAAACCTCGACTTCCTCGAGATGTGGCGGCCCTTCTTCGAACCTTACCACCTCATCATCGTGCAGGACGGAGACCCCAACAGGACCATCAATGTCCCCGAAGGCTTCGATTATGAACTCTACAACCGCAACGACATCAATCGCATCCTCGGACCCAAAGCCTCCTGCATCTCGTTTAAGGATTCTGCGTGTCGCTGCTTTGGTTACATGGTCTCCAAGAAGAAGTACATCTACACCATCGATGACGACTGCTTCGTTGCTAAGGATCCTTCTGGAAAGGATATCAATGCACTTGAGCAGCACATTAAGAATCTCCTTTGTCCATCCACTCCATTTTTTTTCAACACCCTTTATGACCCTTACAGAGAAGGTGCTGATTTCGTCCGTGGATACCCTTTTAGTCTTCGTGAGGGTGCCCCCACTGCTGTTTCTCATGGCCTCTGGCTCAATATACCTGATTATGATGCTCCAACACAGCTTGTCAAACCCCTCGAGAGGAACACCAGGTATGTTGATGCTGTTCTTACCATTCCCAAAGGAACATTGTTCCCCATGTGTGGTATGAATTTGGCATTCGATCGTCAGCTGATTGGACCTGCAATGTACTTTGGACTCATGGGTGATGGCCAACCTATTGGACGATACGATGATATGTGGGCTGGATGGTGTGTTAAGGTTATATGTGACCATTTGGGCTTGGGAGTGAAGACTGGCCTTCCATACATCTGGCACAGCAAAGCAAGCAACCCTTTTGTCAATCTCAAAAAGGAGTACAAGGGCATCTTCTGGCAAGAAGAAATCATTCCATTCTTCCAAAGTGCCACTCTTTCAAAAGAGTGCACGTCTGTCCAAAAATGTTACATTGAACTCTCCAAGCAAGTCAAGGAGAAGCTTGGGGCTGTTGATCCCTACTTCATCAAGCTAGCAGATGCCATGGTTACTTGGATTGAAGCTTGGGATGAGCTTAACAACAACACATCTGAAGAAGTTCCTTCAAAGCCAACCAATGGTGCTGCTGCTGCCAAGTGA

>Glyma01g07930.1   sequence type=predicted peptide   gene model=Glyma01g07930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAQPSSSSKPVVPLLKDELDIVIPTIRNLDFLEMWRPFFEPYHLIIVQDGDPNRTINVPEGFDYELYNRNDINRILGPKASCISFKDSACRCFGYMVSKKKYIYTIDDDCFVAKDPSGKDINALEQHIKNLLCPSTPFFFNTLYDPYREGADFVRGYPFSLREGAPTAVSHGLWLNIPDYDAPTQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLAFDRQLIGPAMYFGLMGDGQPIGRYDDMWAGWCVKVICDHLGLGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQSATLSKECTSVQKCYIELSKQVKEKLGAVDPYFIKLADAMVTWIEAWDELNNNTSEEVPSKPTNGAAAAK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo