SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g07893

Feature Type:gene_model
Chromosome:Gm01
Start:8792136
stop:8793707
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g07893
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G38970AT Annotation by Michelle Graham. TAIR10: brassinosteroid-6-oxidase 1 | chr5:15594935-15597465 REVERSE LENGTH=384 SoyBaseE_val: 7.00E-52ISS
GO:0010268GO-bp Annotation by Michelle Graham. GO Biological Process: brassinosteroid homeostasis SoyBaseN/AISS
GO:0016132GO-bp Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0004497GO-mf Annotation by Michelle Graham. GO Molecular Function: monooxygenase activity SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0016705GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen SoyBaseN/AISS
GO:0019825GO-mf Annotation by Michelle Graham. GO Molecular Function: oxygen binding SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
PTHR24286Panther FAMILY NOT NAMED JGI ISS
PTHR24286:SF21Panther JGI ISS
PF00067PFAM Cytochrome P450 JGI ISS
UniRef100_Q8GSQ1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome P450 85A1 n=2 Tax=Oryza sativa Japonica Group RepID=C85A1_ORYSJ SoyBaseE_val: 2.00E-55ISS
UniRef100_UPI0002337513UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002337513 related cluster n=1 Tax=unknown RepID=UPI0002337513 SoyBaseE_val: 2.00E-92ISS

Expression Patterns of Glyma01g07893
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g07893 not represented in the dataset
Glyma01g07893 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g07893 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g062800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g07893
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g07893
>Glyma01g07893.1   sequence type=CDS   gene model=Glyma01g07893   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTATCAACTACTATAATGATGGTTATCAAATACCTATGTGATAACCCAAGTGATGAGCATTTTGCAATCCAACAAAAGAAAATGTCTGAGGAACGGATCGGCTGGGATGACTACAAGAATATGAGCCTAACTCGTGCGGTGATACTTGAAACCATGAGATTGGTTAGTGTTGTTGCTAGAGTGATGAGGAGGGCCACTAATGATATAGAATCAAATGGTTTTATGATTCCCAAGGGATGGAGAGTTTACTTTTACACAAAGGAGACTAACTTTGACCCGTTCCTCTATGAAGAACCTTTTACTTTTAATCCATGGAGATGGCTGGAGAAGAAAGGCTTGAAGTCTCATAATCACAACATGTTGTTTGGAGCAGGAGGCAGGGTCCTTTTCCTTCACTACTTTGTGACTAGATACAGGGAAAAACTTATGAAATTCCCGAAAGTGTTGGCACCAGAAGGACTACACATAATAGAATACTAG
Predicted protein sequences of Glyma01g07893
>Glyma01g07893.1   sequence type=predicted peptide   gene model=Glyma01g07893   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVSTTIMMVIKYLCDNPSDEHFAIQQKKMSEERIGWDDYKNMSLTRAVILETMRLVSVVARVMRRATNDIESNGFMIPKGWRVYFYTKETNFDPFLYEEPFTFNPWRWLEKKGLKSHNHNMLFGAGGRVLFLHYFVTRYREKLMKFPKVLAPEGLHIIEY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo