SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma01g07876

Feature Type:gene_model
Chromosome:Gm01
Start:8788411
stop:8789743
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma01g07876
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G18230AT Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Oligosaccharide biosynthesis protein Alg14 like (InterPro:IPR013969); Has 640 Blast hits to 640 proteins in 277 species: Archae - 4; Bacteria - 281; Metazoa - 94; Fungi - 127; Plants - 57; Viruses - 0; Other Eukaryotes - 77 (source: NCBI BLink). | chr4:10080521-10081710 REVERSE LENGTH SoyBaseE_val: 1.00E-30ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR12154Panther GLYCOSYL TRANSFERASE-RELATED JGI ISS
PF08660PFAM Oligosaccharide biosynthesis protein Alg14 like JGI ISS
UniRef100_I1J4T6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1J4T6_SOYBN SoyBaseE_val: 4.00E-64ISS
UniRef100_Q84R09UniRef Annotation by Michelle Graham. Most informative UniRef hit: Beta-1,4-N-acetylglucosaminyltransferase n=1 Tax=Arabidopsis thaliana RepID=Q84R09_ARATH SoyBaseE_val: 5.00E-28ISS

Expression Patterns of Glyma01g07876
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma01g07876 not represented in the dataset
Glyma01g07876 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma01g07876 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.01g062700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma01g07876
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma01g07876
>Glyma01g07876.1   sequence type=CDS   gene model=Glyma01g07876   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATAAAAGCAATGGCTGCAGCTTCTCTAGCATATCTTCAATTGTTGTCTTTTCAAGTGTTGTTTTTGTTGTCTCCTTGATTTTGGTTCGTCTCCTTTATGTCTTATACTGTAGCAGCAAGCCCTTGAGCAAAAGGGCTTCAAAACCATTTAGTACCCTTATTATTTTAGGATCAGGTGGTCATATTGCTGAGATGCTTAATCTACTGGCAGTGTTACAGAAAGGTAGGTTAAATCCAAGATTCTACATTGCTGCTGCTACTGATAATATGAGTCTTCAAAAAGCTCAGTTGTTGGAGAATTCCCTGGCTGCTGAGGTTCTATTTTTTGCTATGTCTCTCGAAGTACCTTTTATTCAATGA
Predicted protein sequences of Glyma01g07876
>Glyma01g07876.1   sequence type=predicted peptide   gene model=Glyma01g07876   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDKSNGCSFSSISSIVVFSSVVFVVSLILVRLLYVLYCSSKPLSKRASKPFSTLIILGSGGHIAEMLNLLAVLQKGRLNPRFYIAAATDNMSLQKAQLLENSLAAEVLFFAMSLEVPFIQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo